(data stored in ACNUC9435 zone)

EMBL: CP000031.DXS

CP000031.DXS         Location/Qualifiers
FT   CDS             complement(267660..269588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /locus_tag="SPO0247"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /note="identified by match to protein family HMM PF02779;
FT                   match to protein family HMM PF02780; match to protein
FT                   family HMM TIGR00204"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93567"
FT                   /db_xref="GOA:Q5LX42"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LX42"
FT                   /protein_id="AAV93567.1"
FT                   /translation="MSDRPHTPLLDQVTRPADLKRFSDAQLTQLAGELRAETVSAVSVT
FT                   GGHLGAGLGVVELTVALHAVFDTPRDKVIWDVGHQCYPHKILTERRDRIRTLRMKDGLS
FT                   GFTKRSESPYDPFGAAHSSTSISAALGFAVARDLGGVTPEGLGDAIAVIGDGSMSAGMA
FT                   FEAMNNAGHLKKRLIVILNDNEMSIAPPVGALSNYLSRLYAEEPFQELKAAAKGAVSLL
FT                   PEPFREGAKRAKEMLKGMAVGGTLFEELGFSYIGPIDGHDMGQLLPVLRTVKARATGPI
FT                   LLHVLTKKGKGYAPAERARDRGHATAKFDVVTGEQKKAPSNAPSYTAVFGKALVDQAAR
FT                   DDKIVAVTAAMPDGTGLNLFAERYPSRCFDVGIAEQHGVTFSAALAAGGLKPFCAMYST
FT                   FLQRGYDQVVHDVAIQRLPVRFAIDRAGLVGADGATHAGSFDIAYLANLPGMVVMAAAD
FT                   EAELVHMVATAAAHDDGPIAFRYPRGEGVGVEMPELGKVLEIGKGRMIQKGARVALLSF
FT                   GTRLTEVQKAAEALAARGITPTIADARFAKPLDRDLILNLAHDHEALITIEEGAVGGFG
FT                   SHVAQLLADEGVFDHGLKFRSMVLPDIFIDQSSPADMYAVAGMNAPQIEAKVLDVLGIG
FT                   RIGEKRA"
     MSDRPHTPLL DQVTRPADLK RFSDAQLTQL AGELRAETVS AVSVTGGHLG AGLGVVELTV        60
     ALHAVFDTPR DKVIWDVGHQ CYPHKILTER RDRIRTLRMK DGLSGFTKRS ESPYDPFGAA       120
     HSSTSISAAL GFAVARDLGG VTPEGLGDAI AVIGDGSMSA GMAFEAMNNA GHLKKRLIVI       180
     LNDNEMSIAP PVGALSNYLS RLYAEEPFQE LKAAAKGAVS LLPEPFREGA KRAKEMLKGM       240
     AVGGTLFEEL GFSYIGPIDG HDMGQLLPVL RTVKARATGP ILLHVLTKKG KGYAPAERAR       300
     DRGHATAKFD VVTGEQKKAP SNAPSYTAVF GKALVDQAAR DDKIVAVTAA MPDGTGLNLF       360
     AERYPSRCFD VGIAEQHGVT FSAALAAGGL KPFCAMYSTF LQRGYDQVVH DVAIQRLPVR       420
     FAIDRAGLVG ADGATHAGSF DIAYLANLPG MVVMAAADEA ELVHMVATAA AHDDGPIAFR       480
     YPRGEGVGVE MPELGKVLEI GKGRMIQKGA RVALLSFGTR LTEVQKAAEA LAARGITPTI       540
     ADARFAKPLD RDLILNLAHD HEALITIEEG AVGGFGSHVA QLLADEGVFD HGLKFRSMVL       600
     PDIFIDQSSP ADMYAVAGMN APQIEAKVLD VLGIGRIGEK RA                          642
//

If you have problems or comments...

PBIL Back to PBIL home page