(data stored in ACNUC7421 zone)

EMBL: CP000031.FABI-1

CP000031.FABI-1      Location/Qualifiers
FT   CDS             120115..120879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabI-1"
FT                   /locus_tag="SPO0113"
FT                   /product="enoyl-(acyl-carrier-protein) reductase"
FT                   /EC_number="1.3.1.9"
FT                   /note="identified by similarity to SP:P29132; match to
FT                   protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0113"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93443"
FT                   /db_xref="GOA:Q5LWR9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWR9"
FT                   /protein_id="AAV93443.1"
FT                   /translation="MGLLDGKRGLVVGIANERSIASGCAQAFHREGAELAVTYLNEKAR
FT                   PFVQPVAEALDAEIFMPLDVTADAEMDALFEAIASSWGRLDFILHSVAYCPKEDLHGNV
FT                   LDCSREGFSAAMDISVHSFMRLARRARPLMQNGGCLLTVSYYGAEKVVDHYNVMGPVKA
FT                   ALESTVKYMAAELGPEGIRVNALSPGPLMTRAASGIAHFDALIDEARARAPQQRLVTIE
FT                   DVGNMAAGLVSDAARNVTGNISYVDAGYHVMS"
     MGLLDGKRGL VVGIANERSI ASGCAQAFHR EGAELAVTYL NEKARPFVQP VAEALDAEIF        60
     MPLDVTADAE MDALFEAIAS SWGRLDFILH SVAYCPKEDL HGNVLDCSRE GFSAAMDISV       120
     HSFMRLARRA RPLMQNGGCL LTVSYYGAEK VVDHYNVMGP VKAALESTVK YMAAELGPEG       180
     IRVNALSPGP LMTRAASGIA HFDALIDEAR ARAPQQRLVT IEDVGNMAAG LVSDAARNVT       240
     GNISYVDAGY HVMS                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page