(data stored in ACNUC7421 zone)

EMBL: CP000031.FLGA

CP000031.FLGA        Location/Qualifiers
FT   CDS             complement(196056..196472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgA"
FT                   /locus_tag="SPO0176"
FT                   /product="flagellar basal-body P-ring formation protein
FT                   FlgA"
FT                   /note="identified by similarity to SP:Q44339; match to
FT                   protein family HMM PF03240"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93502"
FT                   /db_xref="GOA:Q5LWX6"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWX6"
FT                   /protein_id="AAV93502.1"
FT                   /translation="MRYLGPILALVLAQTAAAEVLVPTRTIRAKEIIGAEDLMLKSAEV
FT                   PGSFTDPAEVIGQEARVALYAGRPIRYADIGPPAIVDRNDLVTLFFDNGPLVITTEGRA
FT                   LGRGAAGDVIRVMNLTSRTTVSGQIRPNGSIEVK"
     MRYLGPILAL VLAQTAAAEV LVPTRTIRAK EIIGAEDLML KSAEVPGSFT DPAEVIGQEA        60
     RVALYAGRPI RYADIGPPAI VDRNDLVTLF FDNGPLVITT EGRALGRGAA GDVIRVMNLT       120
     SRTTVSGQIR PNGSIEVK                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page