(data stored in ACNUC9435 zone)

EMBL: CP000031.FLGB

CP000031.FLGB        Location/Qualifiers
FT   CDS             complement(198978..199394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /locus_tag="SPO0182"
FT                   /product="flagellar basal-body rod protein; FlgB"
FT                   /note="identified by similarity to SP:P24500; similarity to
FT                   SP:P75934"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93508"
FT                   /db_xref="GOA:Q5LWX1"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWX1"
FT                   /protein_id="AAV93508.1"
FT                   /translation="MKLIEGEAPMFSDLNVFKMAYAMATHAGTRQAVIAQNMANADTPG
FT                   YRERDIAPFAETFARETAGTAMQASRTSHLNGTAASAASWAPFETNAAGDPNRNNVSIE
FT                   EQMLKAVEVKRQHDRALAIYKSSMNMLRVGLGRG"
     MKLIEGEAPM FSDLNVFKMA YAMATHAGTR QAVIAQNMAN ADTPGYRERD IAPFAETFAR        60
     ETAGTAMQAS RTSHLNGTAA SAASWAPFET NAAGDPNRNN VSIEEQMLKA VEVKRQHDRA       120
     LAIYKSSMNM LRVGLGRG                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page