(data stored in ACNUC7421 zone)

EMBL: CP000031.FLGG

CP000031.FLGG        Location/Qualifiers
FT   CDS             complement(196472..197257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgG"
FT                   /locus_tag="SPO0177"
FT                   /product="flagellar basal-body rod protein FlgG"
FT                   /note="identified by similarity to SP:P75939; match to
FT                   protein family HMM PF00460; match to protein family HMM
FT                   PF06429"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93503"
FT                   /db_xref="GOA:Q5LWX5"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWX5"
FT                   /protein_id="AAV93503.1"
FT                   /translation="MRALKIAATGMSAQQMRVETISNNLANMNTTGYNARRAEFADLHY
FT                   QQIARAGTVNASDGTVLPTGVQLGLGVRPAAVTVHLEQGALSATGNDLDLAIEGRGYFE
FT                   VTLPSGQSAFTRDGSLKRSAEGLIVTSDGLSVVPEITIPSDARSISINAAGEVYAYFDD
FT                   AAEGQLLGQVTLAGFTNAKGLEAIGSNLFKETEASGSPITGNPGEDGLGTLRQGYLEDS
FT                   SVDAVREVTELIEAQRGYEMNAKVISAVDQMMSATTQVR"
     MRALKIAATG MSAQQMRVET ISNNLANMNT TGYNARRAEF ADLHYQQIAR AGTVNASDGT        60
     VLPTGVQLGL GVRPAAVTVH LEQGALSATG NDLDLAIEGR GYFEVTLPSG QSAFTRDGSL       120
     KRSAEGLIVT SDGLSVVPEI TIPSDARSIS INAAGEVYAY FDDAAEGQLL GQVTLAGFTN       180
     AKGLEAIGSN LFKETEASGS PITGNPGEDG LGTLRQGYLE DSSVDAVREV TELIEAQRGY       240
     EMNAKVISAV DQMMSATTQV R                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page