(data stored in ACNUC9435 zone)

EMBL: CP000031.FLGH

CP000031.FLGH        Location/Qualifiers
FT   CDS             complement(195319..196059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgH"
FT                   /locus_tag="SPO0175"
FT                   /product="flagellar L-ring protein FlgH"
FT                   /note="identified by similarity to SP:P75940; match to
FT                   protein family HMM PF02107"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93501"
FT                   /db_xref="GOA:Q5LWX7"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWX7"
FT                   /protein_id="AAV93501.1"
FT                   /translation="MMQKCLSPKTLIAALVVLSACGRADHLGKAPSFTPNTESPEHVAM
FT                   LWPGLPLHTQPQRSVDRASLWSGGQNSLLGDQRAMKKGDILTVVIEIDEKAEISNDTNR
FT                   SRSGSESLGVPHLLGLPQRIDEKLPEGASMSNAVAVDSSSASGGKGSVKRKEKLTLRVA
FT                   ATVVDVLPNGVLSITGSQELRVNFELRELLVSGYVRPEDISRQNEITYDKIASARVSYG
FT                   GRGQITDVQQPRYGQQVLDMVLPF"
     MMQKCLSPKT LIAALVVLSA CGRADHLGKA PSFTPNTESP EHVAMLWPGL PLHTQPQRSV        60
     DRASLWSGGQ NSLLGDQRAM KKGDILTVVI EIDEKAEISN DTNRSRSGSE SLGVPHLLGL       120
     PQRIDEKLPE GASMSNAVAV DSSSASGGKG SVKRKEKLTL RVAATVVDVL PNGVLSITGS       180
     QELRVNFELR ELLVSGYVRP EDISRQNEIT YDKIASARVS YGGRGQITDV QQPRYGQQVL       240
     DMVLPF                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page