(data stored in ACNUC9435 zone)

EMBL: CP000031.FLHB

CP000031.FLHB        Location/Qualifiers
FT   CDS             193184..194272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhB"
FT                   /locus_tag="SPO0172"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /note="identified by similarity to SP:P35538; match to
FT                   protein family HMM PF01312"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0172"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93498"
FT                   /db_xref="GOA:Q3V7J5"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V7J5"
FT                   /protein_id="AAV93498.1"
FT                   /translation="MSGQDDDSDKSYEPTPQKLQKAREKGEVAKSADLSVVAAYAGLLL
FT                   ALSALGAASITKLGTALTVLIGQADGLSRLVFEGRAVGPVGGLMGTVGASILPWFLVPA
FT                   AAVILSVVAQRAFVMAPSKLVPKISRISILQNAKNKFGRGGLFEFAKSFVKLLLYSVCL
FT                   GFFIKLNLSDIVSSAGMEARQSVLLMARLLMRFMFLVATVALVIGAIDYLWQHAEHIRK
FT                   NMMSRKELMDETKDAEGDPHMKQKRRQKGQEIAMNQMLADVPGADVVIVNPTHYAVALK
FT                   WSRLPGAAPVCVAKGVDEVAAAIRRSAAEAGVPIHSDPPTARALHAGVEIGQEISEEHY
FT                   RPVAAAIRFAEAMRKRAKGRAW"
     MSGQDDDSDK SYEPTPQKLQ KAREKGEVAK SADLSVVAAY AGLLLALSAL GAASITKLGT        60
     ALTVLIGQAD GLSRLVFEGR AVGPVGGLMG TVGASILPWF LVPAAAVILS VVAQRAFVMA       120
     PSKLVPKISR ISILQNAKNK FGRGGLFEFA KSFVKLLLYS VCLGFFIKLN LSDIVSSAGM       180
     EARQSVLLMA RLLMRFMFLV ATVALVIGAI DYLWQHAEHI RKNMMSRKEL MDETKDAEGD       240
     PHMKQKRRQK GQEIAMNQML ADVPGADVVI VNPTHYAVAL KWSRLPGAAP VCVAKGVDEV       300
     AAAIRRSAAE AGVPIHSDPP TARALHAGVE IGQEISEEHY RPVAAAIRFA EAMRKRAKGR       360
     AW                                                                      362
//

If you have problems or comments...

PBIL Back to PBIL home page