(data stored in ACNUC7421 zone)

EMBL: CP000031.FLIF

CP000031.FLIF        Location/Qualifiers
FT   CDS             complement(216632..218236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /locus_tag="SPO0199"
FT                   /product="flagellar M-ring protein FliF"
FT                   /note="identified by similarity to SP:P25798; match to
FT                   protein family HMM PF01514; match to protein family HMM
FT                   TIGR00206"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93525"
FT                   /db_xref="GOA:Q5LWY9"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWY9"
FT                   /protein_id="AAV93525.1"
FT                   /translation="MQQIRSVWASLDKKKQFIVIGAALVVFLGVLGLTRMAGSPNMQLL
FT                   YAGLESGSAGEVVRSLEQQGVPYEVRGGSIYVPAARRDELRLTLASEGLPANGGRGYEL
FT                   LDSLSGFGTTSQMFDAAYWRAKEGELARTIVASPHVAQARVHIANSSSNPFQRSIEPTA
FT                   SVSVVPSGSEVTPAQANAIRYLVASAVSGMVAEGVTVVDSNGNVIGTPETPTSSTSEDR
FT                   AQQMRERVLRLVEARVGRGNAIVEVSLDTVTETESIRERRFDPNGRVAISTDVEERSDA
FT                   SKNQTTDVTVASNLPDGDGAVGDESNSSTSATRERVNYEVSETETEILRTPGAIKRLSV
FT                   AVLVNGLPGAAQDGSSQFTPRPEEELAALRELVESAVGFNQDRGDVITLKSMELPNLEP
FT                   QGTLASSSMLQGLTFDLMSLIQMATLALVTLVLGLFVVRPILTKPAVSAPLLAVAPPPN
FT                   QSGAQSAGPALTGEIDDGSPRQNQLPGAATQQRGTVPALVGSSGTPVDRLRAMIGDKQE
FT                   ETVEILRSWLEENEEKA"
     MQQIRSVWAS LDKKKQFIVI GAALVVFLGV LGLTRMAGSP NMQLLYAGLE SGSAGEVVRS        60
     LEQQGVPYEV RGGSIYVPAA RRDELRLTLA SEGLPANGGR GYELLDSLSG FGTTSQMFDA       120
     AYWRAKEGEL ARTIVASPHV AQARVHIANS SSNPFQRSIE PTASVSVVPS GSEVTPAQAN       180
     AIRYLVASAV SGMVAEGVTV VDSNGNVIGT PETPTSSTSE DRAQQMRERV LRLVEARVGR       240
     GNAIVEVSLD TVTETESIRE RRFDPNGRVA ISTDVEERSD ASKNQTTDVT VASNLPDGDG       300
     AVGDESNSST SATRERVNYE VSETETEILR TPGAIKRLSV AVLVNGLPGA AQDGSSQFTP       360
     RPEEELAALR ELVESAVGFN QDRGDVITLK SMELPNLEPQ GTLASSSMLQ GLTFDLMSLI       420
     QMATLALVTL VLGLFVVRPI LTKPAVSAPL LAVAPPPNQS GAQSAGPALT GEIDDGSPRQ       480
     NQLPGAATQQ RGTVPALVGS SGTPVDRLRA MIGDKQEETV EILRSWLEEN EEKA             534
//

If you have problems or comments...

PBIL Back to PBIL home page