(data stored in ACNUC7421 zone)

EMBL: CP000031.FLII

CP000031.FLII        Location/Qualifiers
FT   CDS             199455..200792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliI"
FT                   /locus_tag="SPO0183"
FT                   /product="H+-transporting two-sector ATPase,
FT                   flagellum-specific"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by similarity to SP:P26465; match to
FT                   protein family HMM PF00006; match to protein family HMM
FT                   TIGR01026"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0183"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93509"
FT                   /db_xref="GOA:Q5LWX0"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWX0"
FT                   /protein_id="AAV93509.1"
FT                   /translation="MTAPDPLALKAEFDSLSLVRHVGRVTGVAGGVIQIQGLARQAQIG
FT                   DRVELKRNFGPSLGGEVLQVEGSTINMLPDSAPEGVSLGNRVVLHPIPGFAPGRHWLGR
FT                   VVDPFGRPLDGRPLMRGSKARDLMRAPPPAVQRKPLGQRMATGLAALNTLLPIVRGQRV
FT                   GLFAGSGVGKSSLLATLAKSMQADAVVVALIGERGREVNEFVAKALGPEGLARSVIVAA
FT                   TSDQSALVRRRCAWAAMTVAESLRDEGLNVLYLADSITRFAEAHREISAAMGEAPALRG
FT                   YPPSVTPLITGLCERAGPGTEKQGDITGVFSVLVAGSDMDEPVADILRGVLDGHIVLNR
FT                   EIAERGRFPAIDISRSVSRSLPDAATPEQNALIGEARRLIGAYEQSEVMIKAGLYSEGA
FT                   DPLLDQAVRVWPELDAFLARLDPQGIEHSFSRLQLVLRRSKSGPRH"
     MTAPDPLALK AEFDSLSLVR HVGRVTGVAG GVIQIQGLAR QAQIGDRVEL KRNFGPSLGG        60
     EVLQVEGSTI NMLPDSAPEG VSLGNRVVLH PIPGFAPGRH WLGRVVDPFG RPLDGRPLMR       120
     GSKARDLMRA PPPAVQRKPL GQRMATGLAA LNTLLPIVRG QRVGLFAGSG VGKSSLLATL       180
     AKSMQADAVV VALIGERGRE VNEFVAKALG PEGLARSVIV AATSDQSALV RRRCAWAAMT       240
     VAESLRDEGL NVLYLADSIT RFAEAHREIS AAMGEAPALR GYPPSVTPLI TGLCERAGPG       300
     TEKQGDITGV FSVLVAGSDM DEPVADILRG VLDGHIVLNR EIAERGRFPA IDISRSVSRS       360
     LPDAATPEQN ALIGEARRLI GAYEQSEVMI KAGLYSEGAD PLLDQAVRVW PELDAFLARL       420
     DPQGIEHSFS RLQLVLRRSK SGPRH                                             445
//

If you have problems or comments...

PBIL Back to PBIL home page