(data stored in ACNUC7421 zone)

EMBL: CP000031.FLIN

CP000031.FLIN        Location/Qualifiers
FT   CDS             complement(215756..216085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliN"
FT                   /locus_tag="SPO0197"
FT                   /product="flagellar motor switch protein FliN"
FT                   /note="identified by similarity to SP:Q03593; match to
FT                   protein family HMM PF01052"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93523"
FT                   /db_xref="GOA:Q5LWZ1"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWZ1"
FT                   /protein_id="AAV93523.1"
FT                   /translation="MRWTPSCIRPKRYRDMSDPQKPIEAKNPFNSVPIEITVSVGRARP
FT                   LIRDLIGLGENAVLTLDKRVEDPVDLYVGDRLVARGQLEELTGEQAGQLAVRLTEISDL
FT                   ASDLG"
     MRWTPSCIRP KRYRDMSDPQ KPIEAKNPFN SVPIEITVSV GRARPLIRDL IGLGENAVLT        60
     LDKRVEDPVD LYVGDRLVAR GQLEELTGEQ AGQLAVRLTE ISDLASDLG                   109
//

If you have problems or comments...

PBIL Back to PBIL home page