(data stored in ACNUC7421 zone)

EMBL: CP000031.FLIQ

CP000031.FLIQ        Location/Qualifiers
FT   CDS             complement(197995..198267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliQ"
FT                   /locus_tag="SPO0179"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /note="identified by similarity to SP:P35535; match to
FT                   protein family HMM PF01313; match to protein family HMM
FT                   TIGR01402"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0179"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93505"
FT                   /db_xref="GOA:Q3V7J7"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V7J7"
FT                   /protein_id="AAV93505.1"
FT                   /translation="MMSEGLFYDTVRQGLWIAVITSVPILSVALIAGLAVGLFQALTSI
FT                   QEMTLTFVPKLAAIVIVFWISMGFMTQTLVNYFTTTLIPLISGGV"
     MMSEGLFYDT VRQGLWIAVI TSVPILSVAL IAGLAVGLFQ ALTSIQEMTL TFVPKLAAIV        60
     IVFWISMGFM TQTLVNYFTT TLIPLISGGV                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page