(data stored in ACNUC7421 zone)

EMBL: CP000031.FTSE

CP000031.FTSE        Location/Qualifiers
FT   CDS             349240..349971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="SPO0337"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /note="identified by similarity to SP:P10115; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93655"
FT                   /db_xref="GOA:Q5LXB5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXB5"
FT                   /protein_id="AAV93655.1"
FT                   /translation="MKPRAPSGKKSRKRQGADVIELENVGYSYGGGELLGEISVELSPG
FT                   SFHFLTGPSGSGKTTLLKLCYGALLATSGQVRAFGEDMRRLDRDQMALFRRRIGVVHQD
FT                   CRFLDHLPLTENIALPLTVSGHDLAGEHENLRELMAWVGLSKRAEALPPELSGGERQRA
FT                   ALARAVIMSPDVVVADEPTGNVDWEMSQRLLQLLVELNRMGKTVLIATHDLSLIRAAKS
FT                   QVQARVLRISNKRLQLAGADL"
     MKPRAPSGKK SRKRQGADVI ELENVGYSYG GGELLGEISV ELSPGSFHFL TGPSGSGKTT        60
     LLKLCYGALL ATSGQVRAFG EDMRRLDRDQ MALFRRRIGV VHQDCRFLDH LPLTENIALP       120
     LTVSGHDLAG EHENLRELMA WVGLSKRAEA LPPELSGGER QRAALARAVI MSPDVVVADE       180
     PTGNVDWEMS QRLLQLLVEL NRMGKTVLIA THDLSLIRAA KSQVQARVLR ISNKRLQLAG       240
     ADL                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page