(data stored in ACNUC7421 zone)

EMBL: CP000031.GLND

CP000031.GLND        Location/Qualifiers
FT   CDS             complement(408330..411056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="SPO0397"
FT                   /product="protein-P-II uridylyltransferase"
FT                   /EC_number="2.7.7.59"
FT                   /note="identified by match to protein family HMM PF01842;
FT                   match to protein family HMM PF01909; match to protein
FT                   family HMM PF01966; match to protein family HMM TIGR01693"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93715"
FT                   /db_xref="GOA:Q5LWE5"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWE5"
FT                   /protein_id="AAV93715.1"
FT                   /translation="MFDTPAVFARITEAAAEAADNAALRGAVVAILRDVQNAGRAAIAE
FT                   GFAEDPFAARPLTRAYTYLTDGMVKTAMYVASEILHPLATPTQGERIAVLAVGGFGRGE
FT                   MAPFSDVDLLFLTPYKITAWAESVIESMLYILWDLRLKVGHSSRTVKDCIRLGRDDFTI
FT                   RTAMLEHRFLAGHAPLARSLDQRLKSELYKDTQREFIEAKLEERDARHRKQGERYMVEP
FT                   NVKEGKGGLRDLQSLYWIAKYIYEVKETAELVPLGLFTPSEYRTFVQAEEFLWAVRAHL
FT                   HLVTGRATEQLTFDLQVEVAARMGYQDRAGRRGVEVFMQKYFREATRVGELTRIFLTKL
FT                   EAAHMKGAPLLERIFRRRRRIKQGYKVVRGRLDVVDPEAFLADKLNLLRIFEEALRTGM
FT                   LIHPDAMRLVTANLDLIDDGMRNDKEARRIFLDLLLKHGNPERALRRMNELGVLSAFVP
FT                   EFEPIVAMMQFNMYHSYTVDEHTIQTIVNLAQIEKGELVESLPLASSILKAGVNRKVLY
FT                   VALLLHDIGKGRPEDHSILGARIARKVAPRLGLSKADCETVEWLVRYHLLMSDMAQKRD
FT                   ISDPRTVRDFAKAVQTTKRLDLLTVLTVCDIRGVGPNTWNNWKATLLRALHAETKRALE
FT                   MGMEALNREGRGNEAKKALRTALSDWPAGEVKTEIARHYPPYWQGFNVETHVTFAEMLR
FT                   QLEHSGDPGGIEIRLDPDEDRDATRACFAMADHPGIFSRMAGALALVGANVVDARSYTT
FT                   KDGYVTDAFWIQDAEGHPYEAARLPRLSQMILKTLKGEVVARDALKSRDKIKKREKAFN
FT                   VPTHITFDNEGSDIYTIIEVDTRDRPGLLYDLARALAAANVYIANAVIATYGEQVVDSF
FT                   YVKDMFGLKYHSEAKQRTLETKLRKAITEGAERAAAS"
     MFDTPAVFAR ITEAAAEAAD NAALRGAVVA ILRDVQNAGR AAIAEGFAED PFAARPLTRA        60
     YTYLTDGMVK TAMYVASEIL HPLATPTQGE RIAVLAVGGF GRGEMAPFSD VDLLFLTPYK       120
     ITAWAESVIE SMLYILWDLR LKVGHSSRTV KDCIRLGRDD FTIRTAMLEH RFLAGHAPLA       180
     RSLDQRLKSE LYKDTQREFI EAKLEERDAR HRKQGERYMV EPNVKEGKGG LRDLQSLYWI       240
     AKYIYEVKET AELVPLGLFT PSEYRTFVQA EEFLWAVRAH LHLVTGRATE QLTFDLQVEV       300
     AARMGYQDRA GRRGVEVFMQ KYFREATRVG ELTRIFLTKL EAAHMKGAPL LERIFRRRRR       360
     IKQGYKVVRG RLDVVDPEAF LADKLNLLRI FEEALRTGML IHPDAMRLVT ANLDLIDDGM       420
     RNDKEARRIF LDLLLKHGNP ERALRRMNEL GVLSAFVPEF EPIVAMMQFN MYHSYTVDEH       480
     TIQTIVNLAQ IEKGELVESL PLASSILKAG VNRKVLYVAL LLHDIGKGRP EDHSILGARI       540
     ARKVAPRLGL SKADCETVEW LVRYHLLMSD MAQKRDISDP RTVRDFAKAV QTTKRLDLLT       600
     VLTVCDIRGV GPNTWNNWKA TLLRALHAET KRALEMGMEA LNREGRGNEA KKALRTALSD       660
     WPAGEVKTEI ARHYPPYWQG FNVETHVTFA EMLRQLEHSG DPGGIEIRLD PDEDRDATRA       720
     CFAMADHPGI FSRMAGALAL VGANVVDARS YTTKDGYVTD AFWIQDAEGH PYEAARLPRL       780
     SQMILKTLKG EVVARDALKS RDKIKKREKA FNVPTHITFD NEGSDIYTII EVDTRDRPGL       840
     LYDLARALAA ANVYIANAVI ATYGEQVVDS FYVKDMFGLK YHSEAKQRTL ETKLRKAITE       900
     GAERAAAS                                                                908
//

If you have problems or comments...

PBIL Back to PBIL home page