(data stored in ACNUC7421 zone)

EMBL: CP000031.GLPK

CP000031.GLPK        Location/Qualifiers
FT   CDS             106644..108122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="SPO0104"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /note="identified by match to protein family HMM PF00370;
FT                   match to protein family HMM PF02782; match to protein
FT                   family HMM TIGR01311"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93435"
FT                   /db_xref="GOA:Q5LWR1"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWR1"
FT                   /protein_id="AAV93435.1"
FT                   /translation="MTFILAIDQGTTSSRAILFDGEMRRVATAQREFTQHFPEAGWVEH
FT                   DAEEIWQTTVEVCREVIAGQGIGPEQIAGIGITNQRETTVVWDKAGGAPVHRAIVWQDR
FT                   RTAAICERLRHAGCEDDFTAQTGLLLDPYFSGTKVKWILDTVPGARDRAAAGELLFGTI
FT                   DSFLIWRLTGGRVHASDATNAARTLMFDIHQGEWSKDICELLDVPMSMLPEVRDCAADF
FT                   GTTDLFGGQVPILGVAGDQQAATIGQACFQPGMMKSTYGTGCFALLNTGTQPVASQNRL
FT                   LTTIAYQLDGQRTYALEGSIFIAGAAVQWLRDGLGIIENAAQSGALAARADPAQNVILV
FT                   PAFTGLGAPYWKPDCRGAMFGLTRNSGPAEFCKAALESVAYQTRDLWEAMQGDWGADAD
FT                   VILRVDGGMSASDWAMQGLADRLGAPVDRPVMQETTALGAAWLAGMRAGVYPDQAGFAA
FT                   TWALDARFTPKMVEGDREAAYRRWKAAVAAAMMV"
     MTFILAIDQG TTSSRAILFD GEMRRVATAQ REFTQHFPEA GWVEHDAEEI WQTTVEVCRE        60
     VIAGQGIGPE QIAGIGITNQ RETTVVWDKA GGAPVHRAIV WQDRRTAAIC ERLRHAGCED       120
     DFTAQTGLLL DPYFSGTKVK WILDTVPGAR DRAAAGELLF GTIDSFLIWR LTGGRVHASD       180
     ATNAARTLMF DIHQGEWSKD ICELLDVPMS MLPEVRDCAA DFGTTDLFGG QVPILGVAGD       240
     QQAATIGQAC FQPGMMKSTY GTGCFALLNT GTQPVASQNR LLTTIAYQLD GQRTYALEGS       300
     IFIAGAAVQW LRDGLGIIEN AAQSGALAAR ADPAQNVILV PAFTGLGAPY WKPDCRGAMF       360
     GLTRNSGPAE FCKAALESVA YQTRDLWEAM QGDWGADADV ILRVDGGMSA SDWAMQGLAD       420
     RLGAPVDRPV MQETTALGAA WLAGMRAGVY PDQAGFAATW ALDARFTPKM VEGDREAAYR       480
     RWKAAVAAAM MV                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page