(data stored in ACNUC7421 zone)

EMBL: CP000031.GLTX-1

CP000031.GLTX-1      Location/Qualifiers
FT   CDS             445622..446953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX-1"
FT                   /locus_tag="SPO0430"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="identified by similarity to SP:P22249; match to
FT                   protein family HMM PF00749; match to protein family HMM
FT                   TIGR00464"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0430"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93748"
FT                   /db_xref="GOA:Q5LWB2"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWB2"
FT                   /protein_id="AAV93748.1"
FT                   /translation="MSMTTTRFAPSPTGYIHVGNLRTALMNYLIARKAGGTFILRIDDT
FT                   DPERSKEEYVDAIKQDLDWLGLHWDRVERQSERLDRYAEAADKLRAMGRFYEAFETPTE
FT                   LDLKRKKQLNMGKPPVYDRAALALSEGEKEALRAERGNGVWRFKLDQERIEWTDGILGD
FT                   ISIDAASVSDPVLIRGDGQVLYTLASVVDDTDMGVTDVVRGSDHVTNTATQIQIMAALG
FT                   FEHPRFAHHSLLTGPQGEALSKRLGTLALRDLREQGVQPMALLSLMARLGSSDPVELRS
FT                   DMAELIEGFDVTRFGAAPTKFDVQDLFPLTGRYLQALPLEAVAKDVAAAGVPEDLAAPF
FT                   WSMARENITTLNDLAGWWALCRDGAEPLIADEDRAFVTEAMALLPEGPLDADSWGAWTQ
FT                   AVKEATGRKGKGLFMPLRKAVTGMERGPEMATLLPLMQVIRARG"
     MSMTTTRFAP SPTGYIHVGN LRTALMNYLI ARKAGGTFIL RIDDTDPERS KEEYVDAIKQ        60
     DLDWLGLHWD RVERQSERLD RYAEAADKLR AMGRFYEAFE TPTELDLKRK KQLNMGKPPV       120
     YDRAALALSE GEKEALRAER GNGVWRFKLD QERIEWTDGI LGDISIDAAS VSDPVLIRGD       180
     GQVLYTLASV VDDTDMGVTD VVRGSDHVTN TATQIQIMAA LGFEHPRFAH HSLLTGPQGE       240
     ALSKRLGTLA LRDLREQGVQ PMALLSLMAR LGSSDPVELR SDMAELIEGF DVTRFGAAPT       300
     KFDVQDLFPL TGRYLQALPL EAVAKDVAAA GVPEDLAAPF WSMARENITT LNDLAGWWAL       360
     CRDGAEPLIA DEDRAFVTEA MALLPEGPLD ADSWGAWTQA VKEATGRKGK GLFMPLRKAV       420
     TGMERGPEMA TLLPLMQVIR ARG                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page