(data stored in ACNUC7421 zone)

EMBL: CP000031.GYRB

CP000031.GYRB        Location/Qualifiers
FT   CDS             170259..172676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="SPO0155"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00204;
FT                   match to protein family HMM PF00986; match to protein
FT                   family HMM PF01751; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93483"
FT                   /db_xref="GOA:Q5LWU8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWU8"
FT                   /protein_id="AAV93483.1"
FT                   /translation="MSEIEQPGNEYGADSIKVLKGLEAVRKRPGMYIGDTDDGSGLHHM
FT                   VYEVVDNGIDEALAGHADHVTVKIHADSSVSVADNGRGIPVDIHAEEGVSAAEVIMTQL
FT                   HAGGKFDSNSYKVSGGLHGVGVSVVNALSDWLELRIWRHGKEHVARFERGDTVEHLRVV
FT                   GECGDRTGTEVRFLASTTTFSNLDYVFETLEKRLRELAFLNSGVRIILIDERPAERIET
FT                   ELFYEGGVREFVKYLDRSKSPVMPAPIYFKGERDDIGVEIAMWWNDSYHETVLPFTNNI
FT                   PQRDGGTHVAGFRGALTRTINNYAQSSGIAKREKINFTGDDAREGLTCVLSVKVPDPKF
FT                   SSQTKDKLVSSEVRPAVENLVNEKLAEWFEENPNVAKQIVGKIIEAALAREAARKAREL
FT                   TRRKTAMDVNYLAGKLKDCSEKDPSKTEVFLVEGDSAGGSAQTGRDRRTQAVLPLRGKI
FT                   LNVERARFDRMLGSQEIGNLVMALGTGIGRDEFNISKLRYHKIVIMTDADVDGAHIRTL
FT                   LLTFFYRQMPELIEGGYLYIAQPPLYKVARGKSEVYLKDQAALDDYLIHQGVEGAVLKL
FT                   GNGEEIVGQDLTRVVEEARQLKRVLDAFPTHYPRHIMEQAAVAGAFVAGAVDADLQGVA
FT                   DKVAARLDLIALEYERGWLGRITQDHGIRLARILRGVEEVRTLDGPMLRSGEARKTGSF
FT                   TRSLQEIYTQPAMLVRRDRTQAIHGPLTLLKAILDEGEKGLTLQRYKGLGEMNPEQLWE
FT                   TTLDPDARTLLQVRVNDMVEADDIFTKLMGDSVEPRREFIQQNALSVENLDF"
     MSEIEQPGNE YGADSIKVLK GLEAVRKRPG MYIGDTDDGS GLHHMVYEVV DNGIDEALAG        60
     HADHVTVKIH ADSSVSVADN GRGIPVDIHA EEGVSAAEVI MTQLHAGGKF DSNSYKVSGG       120
     LHGVGVSVVN ALSDWLELRI WRHGKEHVAR FERGDTVEHL RVVGECGDRT GTEVRFLAST       180
     TTFSNLDYVF ETLEKRLREL AFLNSGVRII LIDERPAERI ETELFYEGGV REFVKYLDRS       240
     KSPVMPAPIY FKGERDDIGV EIAMWWNDSY HETVLPFTNN IPQRDGGTHV AGFRGALTRT       300
     INNYAQSSGI AKREKINFTG DDAREGLTCV LSVKVPDPKF SSQTKDKLVS SEVRPAVENL       360
     VNEKLAEWFE ENPNVAKQIV GKIIEAALAR EAARKARELT RRKTAMDVNY LAGKLKDCSE       420
     KDPSKTEVFL VEGDSAGGSA QTGRDRRTQA VLPLRGKILN VERARFDRML GSQEIGNLVM       480
     ALGTGIGRDE FNISKLRYHK IVIMTDADVD GAHIRTLLLT FFYRQMPELI EGGYLYIAQP       540
     PLYKVARGKS EVYLKDQAAL DDYLIHQGVE GAVLKLGNGE EIVGQDLTRV VEEARQLKRV       600
     LDAFPTHYPR HIMEQAAVAG AFVAGAVDAD LQGVADKVAA RLDLIALEYE RGWLGRITQD       660
     HGIRLARILR GVEEVRTLDG PMLRSGEARK TGSFTRSLQE IYTQPAMLVR RDRTQAIHGP       720
     LTLLKAILDE GEKGLTLQRY KGLGEMNPEQ LWETTLDPDA RTLLQVRVND MVEADDIFTK       780
     LMGDSVEPRR EFIQQNALSV ENLDF                                             805
//

If you have problems or comments...

PBIL Back to PBIL home page