(data stored in ACNUC7421 zone)

EMBL: CP000031.HPSQ

CP000031.HPSQ        Location/Qualifiers
FT   CDS             616051..616455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpsQ"
FT                   /locus_tag="SPO0597"
FT                   /product="UspA stress protein"
FT                   /note="PMID: 20150239"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0597"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93912"
FT                   /db_xref="GOA:Q5LVU8"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LVU8"
FT                   /protein_id="AAV93912.1"
FT                   /translation="MYHRILVALSLEHGISERALETARALAAEGASIRAVHVIEPPNPA
FT                   VRAYLDADLVAKARADAEARLRARVADAPGVEPVLLSGHSSRALTEYATDMGIDLIIVG
FT                   SHRPGLSDYFLGTTAARVVRHAPCTVMVLR"
     MYHRILVALS LEHGISERAL ETARALAAEG ASIRAVHVIE PPNPAVRAYL DADLVAKARA        60
     DAEARLRARV ADAPGVEPVL LSGHSSRALT EYATDMGIDL IIVGSHRPGL SDYFLGTTAA       120
     RVVRHAPCTV MVLR                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page