(data stored in ACNUC7421 zone)

EMBL: CP000031.HRCA

CP000031.HRCA        Location/Qualifiers
FT   CDS             7130..8194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrcA"
FT                   /locus_tag="SPO0009"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /note="identified by similarity to SP:P54305; match to
FT                   protein family HMM PF01628; match to protein family HMM
FT                   TIGR00331"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93340"
FT                   /db_xref="GOA:Q5LWF5"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWF5"
FT                   /protein_id="AAV93340.1"
FT                   /translation="MSDARKILDDLNDRSREVFRLIVESYLDSGEPVGSRTLTRTLSEK
FT                   VSAATVRNVMQDLEFLGLLDSPHISAGRIPTQMGLRMFVDGLLEVADLSLDDRAKLDAT
FT                   LGTNAGDVGGTLDRISATLSRVTQGASLVLTPKHEAEIRHIEFVSLAQDRALVVLVFSD
FT                   GHVENRLFAPPPGQTPSSMREAANFLNALIEGKTLSEVRRLMQTEIGARQQEIDQLARQ
FT                   MVESGLAVWDREGEEAARLIVRGRANLLEGTGQEQELERIRVLFDDLERKRDIAEFLQL
FT                   TEDGEGVRIFIGSENKLFSLSGSSLVVSPYMNADRKVIGAVGVIGPTRLNYGRIVPIVD
FT                   YTAQLVGRLISDRS"
     MSDARKILDD LNDRSREVFR LIVESYLDSG EPVGSRTLTR TLSEKVSAAT VRNVMQDLEF        60
     LGLLDSPHIS AGRIPTQMGL RMFVDGLLEV ADLSLDDRAK LDATLGTNAG DVGGTLDRIS       120
     ATLSRVTQGA SLVLTPKHEA EIRHIEFVSL AQDRALVVLV FSDGHVENRL FAPPPGQTPS       180
     SMREAANFLN ALIEGKTLSE VRRLMQTEIG ARQQEIDQLA RQMVESGLAV WDREGEEAAR       240
     LIVRGRANLL EGTGQEQELE RIRVLFDDLE RKRDIAEFLQ LTEDGEGVRI FIGSENKLFS       300
     LSGSSLVVSP YMNADRKVIG AVGVIGPTRL NYGRIVPIVD YTAQLVGRLI SDRS             354
//

If you have problems or comments...

PBIL Back to PBIL home page