(data stored in ACNUC7421 zone)

EMBL: CP000031.ILVE

CP000031.ILVE        Location/Qualifiers
FT   CDS             273044..273910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="SPO0253"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /EC_number="2.6.1.42"
FT                   /note="identified by similarity to SP:P00510; match to
FT                   protein family HMM PF01063; match to protein family HMM
FT                   TIGR01122"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93573"
FT                   /db_xref="GOA:Q5LX36"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX36"
FT                   /protein_id="AAV93573.1"
FT                   /translation="MASYDDRDGVIWMDGELVDWRDAKVHILTHAMHYASSVFEGERAY
FT                   NGKIFKSREHSERLVASAQALDMPMPYTVDQIEAAKEETLKASGLTDAYVRALVWRGSG
FT                   EDMGVASARNPVRMAIAVWPWGAYYGDAKMQGAKLDIAEWKRPSPETIPVHAKAAGLYM
FT                   ICTISKHKAEAKGCSDALFMDWRGYVAEATGANVFFVKDGEVHTPLADCFLNGITRQTV
FT                   IGMLKDKGITVHERRIKPEEMEGFEQCWLTGTAAEVTPVGQIGPYTFEVGQMTRDIAAE
FT                   YEALVRA"
     MASYDDRDGV IWMDGELVDW RDAKVHILTH AMHYASSVFE GERAYNGKIF KSREHSERLV        60
     ASAQALDMPM PYTVDQIEAA KEETLKASGL TDAYVRALVW RGSGEDMGVA SARNPVRMAI       120
     AVWPWGAYYG DAKMQGAKLD IAEWKRPSPE TIPVHAKAAG LYMICTISKH KAEAKGCSDA       180
     LFMDWRGYVA EATGANVFFV KDGEVHTPLA DCFLNGITRQ TVIGMLKDKG ITVHERRIKP       240
     EEMEGFEQCW LTGTAAEVTP VGQIGPYTFE VGQMTRDIAA EYEALVRA                    288
//

If you have problems or comments...

PBIL Back to PBIL home page