(data stored in ACNUC7421 zone)

EMBL: CP000031.INFB

CP000031.INFB        Location/Qualifiers
FT   CDS             complement(62848..65355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="SPO0061"
FT                   /product="translation initiation factor IF-2"
FT                   /note="identified by similarity to SP:P02995; match to
FT                   protein family HMM PF00009; match to protein family HMM
FT                   PF03144; match to protein family HMM PF04760; match to
FT                   protein family HMM TIGR00231; match to protein family HMM
FT                   TIGR00487"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0061"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93392"
FT                   /db_xref="GOA:Q5LWL4"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWL4"
FT                   /protein_id="AAV93392.1"
FT                   /translation="MSDTDGKKTLGLRGSRPGNVKQSFSHGRTKNVVVETKRKRVVVPK
FT                   PGAGKPSAGGSSPAGDPSRRPAGISDAEMERRLNALKAAKARESEEAAQREAEEKARAE
FT                   ERERRRAEQEAKEREQREAEQRAREKAEEEERQRREAEEEAKRAAVRAAAEQEAPKAER
FT                   SAERAPAAARPEGGDNARRTTDRDREREQRQTRGKGRQDGRRSGKLTLSQVTDGEGGRQ
FT                   KSLAAMKRKQERARQKAMGGAAEREKVIREVQLPEAIVVSELANRMAERVADVVKELMK
FT                   MGMMVTQNQTIDADTAELIIEEFGHKVVRVSDSDVEDVISDIEDAEEDLKPRPPVITIM
FT                   GHVDHGKTSLLDAIRDAKVVAGEAGGITQHIGAYQVKTDGGATLSFLDTPGHAAFTSMR
FT                   SRGAQVTDIVVLVVAADDAVMPQTVEAINHAKAAGVPMIVAINKIDKPEANPTKVRTDL
FT                   LQHEVVVEAMSGEVQDVEVSAKTGEGLDELLEAIALQAEILELKANPDRPAQGAVIEAQ
FT                   LDVGRGPVATVLIQKGTLRQGDIFVVGEQYGKVRALINDKGERVSEAGPSVPVEVLGLN
FT                   GTPEAGDVLNVTSTEAQAREIAEYRAQVAKDKRAAAGAATTLEQLMAKAKADENVAELP
FT                   ILVKADVQGSAEAIVQAMEKIGNDEVRVRVLHSGVGAITETDVGLAEASGAPIMGFNVR
FT                   ANASARNTANQKGVEIRYYSVIYDLVDDVKAAASGLLSAEIRENFIGYANIKEVFKVSN
FT                   VGKVAGCLVTEGVARRSAGVRLLRDNVVIHEGTLKTLKRFKDEVAEVQSGQECGMAFEN
FT                   YDDIRPGDVIEIFEREEVTRTLT"
     MSDTDGKKTL GLRGSRPGNV KQSFSHGRTK NVVVETKRKR VVVPKPGAGK PSAGGSSPAG        60
     DPSRRPAGIS DAEMERRLNA LKAAKARESE EAAQREAEEK ARAEERERRR AEQEAKEREQ       120
     REAEQRAREK AEEEERQRRE AEEEAKRAAV RAAAEQEAPK AERSAERAPA AARPEGGDNA       180
     RRTTDRDRER EQRQTRGKGR QDGRRSGKLT LSQVTDGEGG RQKSLAAMKR KQERARQKAM       240
     GGAAEREKVI REVQLPEAIV VSELANRMAE RVADVVKELM KMGMMVTQNQ TIDADTAELI       300
     IEEFGHKVVR VSDSDVEDVI SDIEDAEEDL KPRPPVITIM GHVDHGKTSL LDAIRDAKVV       360
     AGEAGGITQH IGAYQVKTDG GATLSFLDTP GHAAFTSMRS RGAQVTDIVV LVVAADDAVM       420
     PQTVEAINHA KAAGVPMIVA INKIDKPEAN PTKVRTDLLQ HEVVVEAMSG EVQDVEVSAK       480
     TGEGLDELLE AIALQAEILE LKANPDRPAQ GAVIEAQLDV GRGPVATVLI QKGTLRQGDI       540
     FVVGEQYGKV RALINDKGER VSEAGPSVPV EVLGLNGTPE AGDVLNVTST EAQAREIAEY       600
     RAQVAKDKRA AAGAATTLEQ LMAKAKADEN VAELPILVKA DVQGSAEAIV QAMEKIGNDE       660
     VRVRVLHSGV GAITETDVGL AEASGAPIMG FNVRANASAR NTANQKGVEI RYYSVIYDLV       720
     DDVKAAASGL LSAEIRENFI GYANIKEVFK VSNVGKVAGC LVTEGVARRS AGVRLLRDNV       780
     VIHEGTLKTL KRFKDEVAEV QSGQECGMAF ENYDDIRPGD VIEIFEREEV TRTLT            835
//

If you have problems or comments...

PBIL Back to PBIL home page