(data stored in ACNUC7421 zone)

EMBL: CP000031.ISPE

CP000031.ISPE        Location/Qualifiers
FT   CDS             330431..331270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="SPO0318"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="identified by match to protein family HMM PF00288;
FT                   match to protein family HMM TIGR00154"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93636"
FT                   /db_xref="GOA:Q5LX98"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LX98"
FT                   /protein_id="AAV93636.1"
FT                   /translation="MAIEAFAPAKINLTLHVTGQRDDGYHLLDSLVVFADIGDTIRVSA
FT                   SDRVSLDIDGPEAGGLAAEPDNLVLRAARLLAPERGAAISLTKRLPVASGIGGGSADAA
FT                   ATLRALAQLWGLAAPSAEQALTLGADVPVCLFPVPARMQGIGDRLGPIPPLPAMDIVLV
FT                   NPRVAVSTPAVFKSLIVKENAPMNPELPRWRDLPEFTCWLADQRNDLAEPAIAQQPVIA
FT                   DVLNALRDAGALFAGMSGSGATCFGLFPSDGHSAKSVAKAVLRLAHPGWWCAHGRVL"
     MAIEAFAPAK INLTLHVTGQ RDDGYHLLDS LVVFADIGDT IRVSASDRVS LDIDGPEAGG        60
     LAAEPDNLVL RAARLLAPER GAAISLTKRL PVASGIGGGS ADAAATLRAL AQLWGLAAPS       120
     AEQALTLGAD VPVCLFPVPA RMQGIGDRLG PIPPLPAMDI VLVNPRVAVS TPAVFKSLIV       180
     KENAPMNPEL PRWRDLPEFT CWLADQRNDL AEPAIAQQPV IADVLNALRD AGALFAGMSG       240
     SGATCFGLFP SDGHSAKSVA KAVLRLAHPG WWCAHGRVL                              279
//

If you have problems or comments...

PBIL Back to PBIL home page