(data stored in ACNUC7421 zone)

EMBL: CP000031.LEUA

CP000031.LEUA        Location/Qualifiers
FT   CDS             complement(435291..436865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="SPO0422"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="identified by match to protein family HMM PF00682;
FT                   match to protein family HMM TIGR00973"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93740"
FT                   /db_xref="GOA:Q5LWC0"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWC0"
FT                   /protein_id="AAV93740.1"
FT                   /translation="MTHVTDQDRVLIFDTTLRDGEQSPGATMTHTEKLEIAEMLDEMGV
FT                   DIIEAGFPIASEGDFKAVSEIAKRAQNSRICGLARANFADIDRCWEAVKHAEKNRIHTF
FT                   IGTSPLHRAIPNLTQDEMAEKIHETVSHARNLCDNVQWSPMDATRTEWDYLCRVIEIAI
FT                   KAGATTINIPDTVGYTAPAESADLIRRLIETVPGADDVIFATHCHNDLGMATANSLAAV
FT                   AGGARQIECTINGLGERAGNTALEEVVMAMKTRHDIMPWRTGIDTTKIMAISRRVATVS
FT                   GFNVQFNKAIVGKNAFAHESGIHQDGMLKNRENFEIMRPEDIGLSGTSLPLGKHSGRAA
FT                   LRDKLEHLGYEVGDNQLKDIFVRFKELADRKKEVFDDDVIALMRSGENAEQDHLQLVSM
FT                   KVICGTGGPAEATVEMEIDGKDVSATAHGDGPVDASFKAIRALHPNEAHLQLYQVHAVT
FT                   EGTDAQATVSVRLEEDGMIATGESANTDTVVASAKAYINALNRLIVRREKAGPGADARE
FT                   ISYKDLT"
     MTHVTDQDRV LIFDTTLRDG EQSPGATMTH TEKLEIAEML DEMGVDIIEA GFPIASEGDF        60
     KAVSEIAKRA QNSRICGLAR ANFADIDRCW EAVKHAEKNR IHTFIGTSPL HRAIPNLTQD       120
     EMAEKIHETV SHARNLCDNV QWSPMDATRT EWDYLCRVIE IAIKAGATTI NIPDTVGYTA       180
     PAESADLIRR LIETVPGADD VIFATHCHND LGMATANSLA AVAGGARQIE CTINGLGERA       240
     GNTALEEVVM AMKTRHDIMP WRTGIDTTKI MAISRRVATV SGFNVQFNKA IVGKNAFAHE       300
     SGIHQDGMLK NRENFEIMRP EDIGLSGTSL PLGKHSGRAA LRDKLEHLGY EVGDNQLKDI       360
     FVRFKELADR KKEVFDDDVI ALMRSGENAE QDHLQLVSMK VICGTGGPAE ATVEMEIDGK       420
     DVSATAHGDG PVDASFKAIR ALHPNEAHLQ LYQVHAVTEG TDAQATVSVR LEEDGMIATG       480
     ESANTDTVVA SAKAYINALN RLIVRREKAG PGADAREISY KDLT                        524
//

If you have problems or comments...

PBIL Back to PBIL home page