(data stored in ACNUC9435 zone)

EMBL: CP000031.LEUB

CP000031.LEUB        Location/Qualifiers
FT   CDS             complement(230495..231598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /locus_tag="SPO0210"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="identified by similarity to SP:Q51375; match to
FT                   protein family HMM PF00180; match to protein family HMM
FT                   TIGR00169"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93535"
FT                   /db_xref="GOA:Q5LWZ5"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWZ5"
FT                   /protein_id="AAV93535.1"
FT                   /translation="MSNPSLLILPGDGIGPEVMAEVRKIIGWFGDKRGLNFDVSEDLVG
FT                   GAAYDVHGVPLADETMAKAQEADAVLLGAVGGPKYDDLDFSVKPERGLLRLRKEMDLFS
FT                   NLRPAQCFDALADFSSLKKDIVAGLDIMIVRELTSGVYFGEPRGIFEEGNERVGINTQR
FT                   YTESEIERVARSAFELAMRRSKKLCSMEKANVMESGILWREVVTRVAKDYPEVELSHMY
FT                   ADNGAMQLVRAPKQFDVILTDNLFGDILSDCAAMLTGSLGMLPSASLGAPMANGRPKAL
FT                   YEPVHGSAPDIAGQGKANPIACILSFAMALRYSFDQGAEADRLEAAVEQVLADGVRTAD
FT                   LLGTEGVTPVSTTEMGAAILAKLDASL"
     MSNPSLLILP GDGIGPEVMA EVRKIIGWFG DKRGLNFDVS EDLVGGAAYD VHGVPLADET        60
     MAKAQEADAV LLGAVGGPKY DDLDFSVKPE RGLLRLRKEM DLFSNLRPAQ CFDALADFSS       120
     LKKDIVAGLD IMIVRELTSG VYFGEPRGIF EEGNERVGIN TQRYTESEIE RVARSAFELA       180
     MRRSKKLCSM EKANVMESGI LWREVVTRVA KDYPEVELSH MYADNGAMQL VRAPKQFDVI       240
     LTDNLFGDIL SDCAAMLTGS LGMLPSASLG APMANGRPKA LYEPVHGSAP DIAGQGKANP       300
     IACILSFAMA LRYSFDQGAE ADRLEAAVEQ VLADGVRTAD LLGTEGVTPV STTEMGAAIL       360
     AKLDASL                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page