(data stored in ACNUC7421 zone)

EMBL: CP000031.LPDA

CP000031.LPDA        Location/Qualifiers
FT   CDS             complement(351721..353109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpdA"
FT                   /locus_tag="SPO0340"
FT                   /product="2-oxoglutarate dehydrogenase, E3 component,
FT                   dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF02852; match to protein
FT                   family HMM TIGR01350"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93660"
FT                   /db_xref="GOA:Q5LXD1"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXD1"
FT                   /protein_id="AAV93660.1"
FT                   /translation="MATYDVIIIGAGPGGYVCAIRCAQLGLKTAVVEGRETLGGTCLNV
FT                   GCIPSKALLHASHSLHEAQHNFAKMGLKGKSPSVDWKQMLAYKDEVIEGNTKGIEFLFK
FT                   KNKIDWIKGWASIPAAGKVQVGDDTHEAKNIIIASGSEPASLPGVEVDEKTVVTSTGAL
FT                   ELGKIPKSLVVIGAGVIGLELGSVYARLGAEVTVVEFLDVITPGMDGEVQKTFQRILKK
FT                   QGLTFVMGAAVQKTEIARGKAKVTYKLLKKDTEHEIEADTVLVATGRKPYTAGLGLDKL
FT                   GIEMTQRGQIKVGKDWQTNVPGIYAIGDVIEGPMLAHKAEDEGMAAAEQVAGKHGHVNY
FT                   GVIPGVIYTTPEVANVGATEESLKAEGRAYKVGKFMFMGNGRAKANFASDGFVKILADK
FT                   ETDRILGAHIIGPAAGELIHEVCVAMEFGASAEDLALTCHAHPTYSEAVREAALACGDG
FT                   PIHS"
     MATYDVIIIG AGPGGYVCAI RCAQLGLKTA VVEGRETLGG TCLNVGCIPS KALLHASHSL        60
     HEAQHNFAKM GLKGKSPSVD WKQMLAYKDE VIEGNTKGIE FLFKKNKIDW IKGWASIPAA       120
     GKVQVGDDTH EAKNIIIASG SEPASLPGVE VDEKTVVTST GALELGKIPK SLVVIGAGVI       180
     GLELGSVYAR LGAEVTVVEF LDVITPGMDG EVQKTFQRIL KKQGLTFVMG AAVQKTEIAR       240
     GKAKVTYKLL KKDTEHEIEA DTVLVATGRK PYTAGLGLDK LGIEMTQRGQ IKVGKDWQTN       300
     VPGIYAIGDV IEGPMLAHKA EDEGMAAAEQ VAGKHGHVNY GVIPGVIYTT PEVANVGATE       360
     ESLKAEGRAY KVGKFMFMGN GRAKANFASD GFVKILADKE TDRILGAHII GPAAGELIHE       420
     VCVAMEFGAS AEDLALTCHA HPTYSEAVRE AALACGDGPI HS                          462
//

If you have problems or comments...

PBIL Back to PBIL home page