(data stored in ACNUC7421 zone)

EMBL: CP000031.LUXR-1

CP000031.LUXR-1      Location/Qualifiers
FT   CDS             385883..386602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="luxR-1"
FT                   /locus_tag="SPO0371"
FT                   /product="autoinducer-binding transcriptional regulator
FT                   LuxR"
FT                   /note="identified by match to protein family HMM PF00196;
FT                   match to protein family HMM PF03472"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93689"
FT                   /db_xref="GOA:Q5LXF5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXF5"
FT                   /protein_id="AAV93689.1"
FT                   /translation="MGRKVNLNPILEDLDATSALEDLERVTIKLRDTLEIDHIVYHWVD
FT                   SAGDQYGCATYPKAWQERYLERNYHRIDPVILGCFQRFHPVDWKRLDWSGKVAKAFLQD
FT                   ALKHGVGNQGYSIPIRGPNGQFALFTVNHVCDDQAWSEFTEIYGRDLILIAHFFNRKAL
FT                   EFERSRQPDQPRNLSPREVDAMTLLALGYSRAQVAHSLSISEHTLRVYIESARFKLGAL
FT                   NTTHAIATAMSRGLIVV"
     MGRKVNLNPI LEDLDATSAL EDLERVTIKL RDTLEIDHIV YHWVDSAGDQ YGCATYPKAW        60
     QERYLERNYH RIDPVILGCF QRFHPVDWKR LDWSGKVAKA FLQDALKHGV GNQGYSIPIR       120
     GPNGQFALFT VNHVCDDQAW SEFTEIYGRD LILIAHFFNR KALEFERSRQ PDQPRNLSPR       180
     EVDAMTLLAL GYSRAQVAHS LSISEHTLRV YIESARFKLG ALNTTHAIAT AMSRGLIVV        239
//

If you have problems or comments...

PBIL Back to PBIL home page