(data stored in ACNUC9435 zone)

EMBL: CP000031.LYSA

CP000031.LYSA        Location/Qualifiers
FT   CDS             344379..345644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysA"
FT                   /locus_tag="SPO0334"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /note="identified by match to protein family HMM PF00278;
FT                   match to protein family HMM PF02784; match to protein
FT                   family HMM TIGR01048"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0334"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93652"
FT                   /db_xref="GOA:Q5LXB8"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXB8"
FT                   /protein_id="AAV93652.1"
FT                   /translation="MDHFLYRDGALCAEDVPLAEIAATVGSPFYVYSTATLLRHFQLFD
FT                   EALDGTDHLICYAMKAASNQAILRTLAQAGAGMDVVSVGEYLRARAAGVPGVRIVFSGV
FT                   GKTAEEIRVALVGGIRQFNVESEPEMEVINAIALELGKVAPITIRVNPDVDAKTHAKIA
FT                   TGKSENKFGIPIARASAVYAQAAALPGLEVVGIDVHIGSQLTDLAPFETAYRKVAELTE
FT                   RLRAEGHDIRRLDLGGGLGIPYTRSNEAPPLPMEYGALIKRTLGHLGCEIEIEPGRLIA
FT                   GNAGLMVSKVIYVKSGEGRDFLILDAAMNDLIRPAMYDAHHDIVPVVEPEPGVEPQPYD
FT                   IVGPVCESGDTFAKARMMPPLAAGDLVAFRSAGAYGAVMSSEYNSRPLIPEVLVHGDQF
FT                   AVIRPRPSFDEMINRDTIPPWL"
     MDHFLYRDGA LCAEDVPLAE IAATVGSPFY VYSTATLLRH FQLFDEALDG TDHLICYAMK        60
     AASNQAILRT LAQAGAGMDV VSVGEYLRAR AAGVPGVRIV FSGVGKTAEE IRVALVGGIR       120
     QFNVESEPEM EVINAIALEL GKVAPITIRV NPDVDAKTHA KIATGKSENK FGIPIARASA       180
     VYAQAAALPG LEVVGIDVHI GSQLTDLAPF ETAYRKVAEL TERLRAEGHD IRRLDLGGGL       240
     GIPYTRSNEA PPLPMEYGAL IKRTLGHLGC EIEIEPGRLI AGNAGLMVSK VIYVKSGEGR       300
     DFLILDAAMN DLIRPAMYDA HHDIVPVVEP EPGVEPQPYD IVGPVCESGD TFAKARMMPP       360
     LAAGDLVAFR SAGAYGAVMS SEYNSRPLIP EVLVHGDQFA VIRPRPSFDE MINRDTIPPW       420
     L                                                                       421
//

If you have problems or comments...

PBIL Back to PBIL home page