(data stored in ACNUC9435 zone)

EMBL: CP000031.MOBA

CP000031.MOBA        Location/Qualifiers
FT   CDS             320619..321254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mobA"
FT                   /locus_tag="SPO0307"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A"
FT                   /note="identified by similarity to SP:P32173"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0307"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93625"
FT                   /db_xref="GOA:Q5LX91"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX91"
FT                   /protein_id="AAV93625.1"
FT                   /translation="MTKPLGVILAGGLATRMGGGDKGLLPLGGQPLLGHVIDRLAPQVS
FT                   GLALNANGDPARFNGFGLPVLPDTVEGFAGPLAGVLAGLDWAAGQRADSIVTAAADTPF
FT                   FPRDLVARLVAASEGQAHPLVLATTPRDGAVLKSGGRVNRHPTFGLWPVALRDDLRAAL
FT                   NDGLRKVVLWTDRHGGREALFQAEPFDPFFNVNTPEDLARAETLLERA"
     MTKPLGVILA GGLATRMGGG DKGLLPLGGQ PLLGHVIDRL APQVSGLALN ANGDPARFNG        60
     FGLPVLPDTV EGFAGPLAGV LAGLDWAAGQ RADSIVTAAA DTPFFPRDLV ARLVAASEGQ       120
     AHPLVLATTP RDGAVLKSGG RVNRHPTFGL WPVALRDDLR AALNDGLRKV VLWTDRHGGR       180
     EALFQAEPFD PFFNVNTPED LARAETLLER A                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page