(data stored in ACNUC9435 zone)

EMBL: CP000031.MOBB

CP000031.MOBB        Location/Qualifiers
FT   CDS             321251..321742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mobB"
FT                   /locus_tag="SPO0308"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein B"
FT                   /note="identified by similarity to SP:P32125; match to
FT                   protein family HMM PF03205; match to protein family HMM
FT                   TIGR00176"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0308"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93626"
FT                   /db_xref="GOA:Q5LX90"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX90"
FT                   /protein_id="AAV93626.1"
FT                   /translation="MRIYGVTGWKNAGKTGLMERLVAEITGRGLTVSTVKHAHHSFDVD
FT                   HPGRDSWRHRQAGASEVILASRYRVAQMTELRGAAEPPLSELLGRLSPVDLVLIEGYKR
FT                   EGHPKVEAFRAEAGTALIAPGDPTIRAVASDTPLTLDRPVFDLNDTTAIADFILSEVGL
FT                   "
     MRIYGVTGWK NAGKTGLMER LVAEITGRGL TVSTVKHAHH SFDVDHPGRD SWRHRQAGAS        60
     EVILASRYRV AQMTELRGAA EPPLSELLGR LSPVDLVLIE GYKREGHPKV EAFRAEAGTA       120
     LIAPGDPTIR AVASDTPLTL DRPVFDLNDT TAIADFILSE VGL                         163
//

If you have problems or comments...

PBIL Back to PBIL home page