(data stored in ACNUC7421 zone)

EMBL: CP000031.MOEA

CP000031.MOEA        Location/Qualifiers
FT   CDS             322536..323795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moeA"
FT                   /locus_tag="SPO0310"
FT                   /product="molybdopterin biosynthesis protein MoeA"
FT                   /note="identified by similarity to SP:P12281; match to
FT                   protein family HMM PF00994; match to protein family HMM
FT                   PF03453; match to protein family HMM PF03454; match to
FT                   protein family HMM TIGR00177"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0310"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93628"
FT                   /db_xref="GOA:Q5LX88"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX88"
FT                   /protein_id="AAV93628.1"
FT                   /translation="MTGIEPPPLRNDCFALPAGVEWTPVDTALDMLRDRLGPVTGVEMR
FT                   LLSQALGGVLAADAVALRSSPPQANSAVDGYGFAGAVPEGAHVMPLEEGRAAAGVPFDG
FT                   VLPAGRALRVLTGAALPEGVETVILEEDVTLGTGEIAFRGPLKRGANTRKAGEDVAEGA
FT                   VVLPAGRRLTPADLALLASVGLGVVPLRRQLRVAVLSTGDELVEPGETAGPGQIFDANR
FT                   PMLLSLIHRLGHAPVDLGRVPDDRTTLRATFDRAAAEADVILTSGGASAGDEDHVSALL
FT                   RAAGAMQQWRIALKPGRPLALGLWQGKPVFGLPGNPVAALVCSLVFARPAMAVLAGESW
FT                   SVPQGYDLPAGFEKRKKPGRREYLRARVRDGRVEVFASEGSGRVSGLSWAEGLVEIGDD
FT                   ACHIRPGDPVRFIPYGSFGL"
     MTGIEPPPLR NDCFALPAGV EWTPVDTALD MLRDRLGPVT GVEMRLLSQA LGGVLAADAV        60
     ALRSSPPQAN SAVDGYGFAG AVPEGAHVMP LEEGRAAAGV PFDGVLPAGR ALRVLTGAAL       120
     PEGVETVILE EDVTLGTGEI AFRGPLKRGA NTRKAGEDVA EGAVVLPAGR RLTPADLALL       180
     ASVGLGVVPL RRQLRVAVLS TGDELVEPGE TAGPGQIFDA NRPMLLSLIH RLGHAPVDLG       240
     RVPDDRTTLR ATFDRAAAEA DVILTSGGAS AGDEDHVSAL LRAAGAMQQW RIALKPGRPL       300
     ALGLWQGKPV FGLPGNPVAA LVCSLVFARP AMAVLAGESW SVPQGYDLPA GFEKRKKPGR       360
     REYLRARVRD GRVEVFASEG SGRVSGLSWA EGLVEIGDDA CHIRPGDPVR FIPYGSFGL        419
//

If you have problems or comments...

PBIL Back to PBIL home page