(data stored in ACNUC7421 zone)

EMBL: CP000031.MOTA

CP000031.MOTA        Location/Qualifiers
FT   CDS             219941..220810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motA"
FT                   /locus_tag="SPO0203"
FT                   /product="chemotaxis protein MotA"
FT                   /note="identified by similarity to SP:P09348; match to
FT                   protein family HMM PF01618"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0203"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93529"
FT                   /db_xref="GOA:Q5LX01"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR022522"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX01"
FT                   /protein_id="AAV93529.1"
FT                   /translation="MIGILGIVVIFVMVFGGYLAAGGKMTIILKSLPFEMMMIGGAATG
FT                   AFLISNDMGGVKHTLKDVGKVFKGPKWKPEDYRDLLCLLFSLIRIARQNPVEVEQHIED
FT                   PASSALFSKYPRIQADHEAVDLICDTMRSASMNYDDPHQVEEVLEKRMEANLHHAMHSS
FT                   HALQTVADGLPALGIVAAVLGVIKTMGSIDQPPEVLGRLIGGALVGTFLGVFLAYGLVG
FT                   PFASKVKAVVEEDNHFYLLIKEVLVANLHNHNPAMCIEVGRQNTPSHIRPGFTDLEQAL
FT                   KDLKQDAA"
     MIGILGIVVI FVMVFGGYLA AGGKMTIILK SLPFEMMMIG GAATGAFLIS NDMGGVKHTL        60
     KDVGKVFKGP KWKPEDYRDL LCLLFSLIRI ARQNPVEVEQ HIEDPASSAL FSKYPRIQAD       120
     HEAVDLICDT MRSASMNYDD PHQVEEVLEK RMEANLHHAM HSSHALQTVA DGLPALGIVA       180
     AVLGVIKTMG SIDQPPEVLG RLIGGALVGT FLGVFLAYGL VGPFASKVKA VVEEDNHFYL       240
     LIKEVLVANL HNHNPAMCIE VGRQNTPSHI RPGFTDLEQA LKDLKQDAA                   289
//

If you have problems or comments...

PBIL Back to PBIL home page