(data stored in ACNUC7421 zone)

EMBL: CP000031.MOTB

CP000031.MOTB        Location/Qualifiers
FT   CDS             209006..209863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motB"
FT                   /locus_tag="SPO0191"
FT                   /product="chemotaxis protein MotB"
FT                   /note="identified by similarity to SP:P09349"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0191"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93517"
FT                   /db_xref="GOA:Q5LWX9"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWX9"
FT                   /protein_id="AAV93517.1"
FT                   /translation="MIMKVVEMGAHTNAAPIIIKKKKSGGGDGHHGGAWKVAYADFVTA
FT                   MMAFFMLMWLLNATTEKQRKGLADYFSDSIPINPVSGGGDGSFGGDSMFSENAMVTTGT
FT                   GGVNRRRADADRSRGSTGVDRQGGEGEPLEEFKTLEAALQGRGGESLVSEQLRKHIVTR
FT                   VTDEGLIVELISTDESPLFETNSDRPTQLMKELAKVVVRAADMVSNGIAVGGHIRAHPV
FT                   VLARNPVWELSTARAERTRVLFEGLGMKEERIQRVTGHADRKLTDPNPMAARNDRIEII
FT                   FLRS"
     MIMKVVEMGA HTNAAPIIIK KKKSGGGDGH HGGAWKVAYA DFVTAMMAFF MLMWLLNATT        60
     EKQRKGLADY FSDSIPINPV SGGGDGSFGG DSMFSENAMV TTGTGGVNRR RADADRSRGS       120
     TGVDRQGGEG EPLEEFKTLE AALQGRGGES LVSEQLRKHI VTRVTDEGLI VELISTDESP       180
     LFETNSDRPT QLMKELAKVV VRAADMVSNG IAVGGHIRAH PVVLARNPVW ELSTARAERT       240
     RVLFEGLGMK EERIQRVTGH ADRKLTDPNP MAARNDRIEI IFLRS                       285
//

If you have problems or comments...

PBIL Back to PBIL home page