(data stored in ACNUC7421 zone)

EMBL: CP000031.MREC

CP000031.MREC        Location/Qualifiers
FT   CDS             complement(432207..433142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreC"
FT                   /locus_tag="SPO0419"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="identified by similarity to SP:P16926; match to
FT                   protein family HMM PF04085; match to protein family HMM
FT                   TIGR00219"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0419"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93737"
FT                   /db_xref="GOA:Q5LWC3"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWC3"
FT                   /protein_id="AAV93737.1"
FT                   /translation="MAERTSLARDRSQREDYAGPLRRLLLGVLLLCLLGIFLVWRIDSP
FT                   RVERFRAQVVDTVIPSMDWAMVPVTGTINLIRDFQSYQRLSEQNRELRSELRQMRAWKE
FT                   AALQLEQENARLLDLNNVRLDPRLTYITGVVMADSGSPFRQSVLLNVGARDGIVDGWAA
FT                   MDGIGLVGRISGVGQSSARVILLTDAASSIPATIQPSGQTALITGDNTAAPVVDFLENR
FT                   ELVRPGDRVVTSGDGGVFPAGLLIGQVAEDRTGRLRVRLSADYERLEFLRVLRHHGTEK
FT                   IEDHGDVVGPPAPAAPDTSALTTPAEATDG"
     MAERTSLARD RSQREDYAGP LRRLLLGVLL LCLLGIFLVW RIDSPRVERF RAQVVDTVIP        60
     SMDWAMVPVT GTINLIRDFQ SYQRLSEQNR ELRSELRQMR AWKEAALQLE QENARLLDLN       120
     NVRLDPRLTY ITGVVMADSG SPFRQSVLLN VGARDGIVDG WAAMDGIGLV GRISGVGQSS       180
     ARVILLTDAA SSIPATIQPS GQTALITGDN TAAPVVDFLE NRELVRPGDR VVTSGDGGVF       240
     PAGLLIGQVA EDRTGRLRVR LSADYERLEF LRVLRHHGTE KIEDHGDVVG PPAPAAPDTS       300
     ALTTPAEATD G                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page