(data stored in ACNUC7421 zone)

EMBL: CP000031.MRED

CP000031.MRED        Location/Qualifiers
FT   CDS             complement(428594..429733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreD"
FT                   /locus_tag="SPO0416"
FT                   /product="rod shape-determining protein MreD"
FT                   /note="identified by similarity to SP:P15035; match to
FT                   protein family HMM PF01098; match to protein family HMM
FT                   TIGR02210"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0416"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93734"
FT                   /db_xref="GOA:Q5LWC6"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWC6"
FT                   /protein_id="AAV93734.1"
FT                   /translation="MSYLEYTVKSTPSGLRKILYMNWPLTLLLISVASAGFLMLYSVAG
FT                   GSFSPWAEPQIKRFMAGLVVMTAVAMVPIWFWRNMAAVAYGGSLVLLVMVELFGAVGMG
FT                   AQRWIDLGFMRLQPSELTKITLVMVLAAYYDWLPGKKTSRPLWVLVPVLIILVPTALVL
FT                   KQPDLGTAILLLSAGGALMFLAGVHWAYFAAVIAAGVGLITAVFKSRGTDWQLLKDYQF
FT                   RRIDTFLDPSSDPLGAGYHITQSKIALGSGGWSGRGFMQGTQSRLNFLPEKHTDFIFTT
FT                   LAEEFGFIGGISLLSLYALIIAFCVATALATRDRFSSLVTLGIAVNFFLFFAVNMSMVM
FT                   GLAPVVGVPLPMVSYGGSAMLVLLVAFGLVHSAHIHRPR"
     MSYLEYTVKS TPSGLRKILY MNWPLTLLLI SVASAGFLML YSVAGGSFSP WAEPQIKRFM        60
     AGLVVMTAVA MVPIWFWRNM AAVAYGGSLV LLVMVELFGA VGMGAQRWID LGFMRLQPSE       120
     LTKITLVMVL AAYYDWLPGK KTSRPLWVLV PVLIILVPTA LVLKQPDLGT AILLLSAGGA       180
     LMFLAGVHWA YFAAVIAAGV GLITAVFKSR GTDWQLLKDY QFRRIDTFLD PSSDPLGAGY       240
     HITQSKIALG SGGWSGRGFM QGTQSRLNFL PEKHTDFIFT TLAEEFGFIG GISLLSLYAL       300
     IIAFCVATAL ATRDRFSSLV TLGIAVNFFL FFAVNMSMVM GLAPVVGVPL PMVSYGGSAM       360
     LVLLVAFGLV HSAHIHRPR                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page