(data stored in ACNUC9435 zone)

EMBL: CP000031.MSRA-1

CP000031.MSRA-1      Location/Qualifiers
FT   CDS             complement(14726..15388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA-1"
FT                   /locus_tag="SPO0014"
FT                   /product="methionine-S-sulfoxide reductase"
FT                   /EC_number="1.8.4.-"
FT                   /note="identified by similarity to SP:Q93P63; match to
FT                   protein family HMM PF01625; match to protein family HMM
FT                   TIGR00401"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0014"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93345"
FT                   /db_xref="GOA:Q5LWG7"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWG7"
FT                   /protein_id="AAV93345.1"
FT                   /translation="MFPIQTLKPIALIAAMALATILQGGKAEAAETQTLTVAGGCFWCV
FT                   EADFEKVPGVLGAVSGYTGGTLDNPTYKQVTRGGTGHFEAVQILFDPDQVSRERLLHMF
FT                   FRSVDPTDAGGQFCDRGDSYRTAIFVSNKVESALASQAKANAEAELGQTVVTPILTAGR
FT                   FYPAEAYHQDYAKGEKLVLTRFGPKRQQEAYKLYRKSCGRDARVKQLWGDAAPFAGS"
     MFPIQTLKPI ALIAAMALAT ILQGGKAEAA ETQTLTVAGG CFWCVEADFE KVPGVLGAVS        60
     GYTGGTLDNP TYKQVTRGGT GHFEAVQILF DPDQVSRERL LHMFFRSVDP TDAGGQFCDR       120
     GDSYRTAIFV SNKVESALAS QAKANAEAEL GQTVVTPILT AGRFYPAEAY HQDYAKGEKL       180
     VLTRFGPKRQ QEAYKLYRKS CGRDARVKQL WGDAAPFAGS                             220
//

If you have problems or comments...

PBIL Back to PBIL home page