(data stored in ACNUC7421 zone)

EMBL: CP000031.MUTM

CP000031.MUTM        Location/Qualifiers
FT   CDS             161604..162455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM"
FT                   /locus_tag="SPO0146"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="identified by match to protein family HMM PF01149;
FT                   match to protein family HMM PF06831; match to protein
FT                   family HMM TIGR00577"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93474"
FT                   /db_xref="GOA:Q5LWT9"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWT9"
FT                   /protein_id="AAV93474.1"
FT                   /translation="MPELPEVETVRRGLAPAMEGAVIARAEVNRPDLRWPFPDRMAERL
FT                   TGQRVERLRRRSKYILADLSGGETLLIHLGMSGRMTVSGDPLGQFVHDHPAAQKHDHVV
FT                   FHMDNGARITFNDPRRFGAMDLMATATADEHKLLMVLGPEPLGNDFHEDYLVAALKGRN
FT                   TPVKSALLDQGIVAGLGNIYVCEALFRAGVSPRRKAGQIAAARVSALVPIIRQVLSEAI
FT                   EAGGSSLKDFRQADGELGYFQHSFDVYGREGEPCRRAGCDGTVQRITQSGRSSFYCAQC
FT                   QR"
     MPELPEVETV RRGLAPAMEG AVIARAEVNR PDLRWPFPDR MAERLTGQRV ERLRRRSKYI        60
     LADLSGGETL LIHLGMSGRM TVSGDPLGQF VHDHPAAQKH DHVVFHMDNG ARITFNDPRR       120
     FGAMDLMATA TADEHKLLMV LGPEPLGNDF HEDYLVAALK GRNTPVKSAL LDQGIVAGLG       180
     NIYVCEALFR AGVSPRRKAG QIAAARVSAL VPIIRQVLSE AIEAGGSSLK DFRQADGELG       240
     YFQHSFDVYG REGEPCRRAG CDGTVQRITQ SGRSSFYCAQ CQR                         283
//

If you have problems or comments...

PBIL Back to PBIL home page