(data stored in ACNUC7421 zone)

EMBL: CP000031.MUTT

CP000031.MUTT        Location/Qualifiers
FT   CDS             61973..62371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /locus_tag="SPO0060"
FT                   /product="mutator mutT protein"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00293;
FT                   match to protein family HMM TIGR00586"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0060"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93391"
FT                   /db_xref="GOA:Q5LWL5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWL5"
FT                   /protein_id="AAV93391.1"
FT                   /translation="MKTVLVSAVALIDVDGRVLLAQRPEGKSMAGLWEFPGGKVEPGET
FT                   PEVALIRELHEELGINTWASCLAPLTFASHGYDDFHLLMPLFACRKWEGIPQSREGQAL
FT                   KWVRATELRNYPMPPADVPLIPILRDWL"
     MKTVLVSAVA LIDVDGRVLL AQRPEGKSMA GLWEFPGGKV EPGETPEVAL IRELHEELGI        60
     NTWASCLAPL TFASHGYDDF HLLMPLFACR KWEGIPQSRE GQALKWVRAT ELRNYPMPPA       120
     DVPLIPILRD WL                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page