(data stored in ACNUC7421 zone)

EMBL: CP000031.MVIN

CP000031.MVIN        Location/Qualifiers
FT   CDS             complement(406792..408333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mviN"
FT                   /locus_tag="SPO0396"
FT                   /product="integral membrane protein MviN"
FT                   /note="identified by similarity to SP:O05467; match to
FT                   protein family HMM PF03023; match to protein family HMM
FT                   TIGR01695"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0396"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93714"
FT                   /db_xref="GOA:Q5LWE6"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWE6"
FT                   /protein_id="AAV93714.1"
FT                   /translation="MKPIRLMAGFFTVGFWTLASRILGFAREILLAAYIGPGPVMDAFV
FT                   AAFRLPNLFRRFFAEGAFNAAFVPMFSKRLEGGEDAEGFAQQAFNLLGAAVLTLVALAM
FT                   IFMPALIWATASGFVGDERFDLAVGYGKIAFPYILFMSLAALFSGVLNATGRFAAAAAA
FT                   PVLLNVFACAAMLAGSALGGEVIDWLIWVIPVAGVAQLALVWVAAERAGIRLRPGLPRL
FT                   SPAMRRLVRVAFPAALAMGVTQINLVVGQLVASRTESAVSWLFTADRLYQLPLGVVGIA
FT                   VGIVLLPDLSRRLRAGDDTGAREAYSRAGEFSLILTLPSAMALMAIPLPLVAVLFQRGA
FT                   FTPEDSAATAIAVAIYGLGLPAFMLQKVFQPLFFAREDTKSPFRYAVVAMVINAVLAFA
FT                   LYPLLGWIAPAIATTVAGWTMVAQLALGARRMGEVARFDTRFHGRAWRILMASLIMGAA
FT                   LYAVLIPLGWVFDLPSWRYLGLLALILFAAVVYFGVGHLIGAFRLSEFRRALRRS"
     MKPIRLMAGF FTVGFWTLAS RILGFAREIL LAAYIGPGPV MDAFVAAFRL PNLFRRFFAE        60
     GAFNAAFVPM FSKRLEGGED AEGFAQQAFN LLGAAVLTLV ALAMIFMPAL IWATASGFVG       120
     DERFDLAVGY GKIAFPYILF MSLAALFSGV LNATGRFAAA AAAPVLLNVF ACAAMLAGSA       180
     LGGEVIDWLI WVIPVAGVAQ LALVWVAAER AGIRLRPGLP RLSPAMRRLV RVAFPAALAM       240
     GVTQINLVVG QLVASRTESA VSWLFTADRL YQLPLGVVGI AVGIVLLPDL SRRLRAGDDT       300
     GAREAYSRAG EFSLILTLPS AMALMAIPLP LVAVLFQRGA FTPEDSAATA IAVAIYGLGL       360
     PAFMLQKVFQ PLFFAREDTK SPFRYAVVAM VINAVLAFAL YPLLGWIAPA IATTVAGWTM       420
     VAQLALGARR MGEVARFDTR FHGRAWRILM ASLIMGAALY AVLIPLGWVF DLPSWRYLGL       480
     LALILFAAVV YFGVGHLIGA FRLSEFRRAL RRS                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page