(data stored in ACNUC9435 zone)

EMBL: CP000031.NADE

CP000031.NADE        Location/Qualifiers
FT   CDS             440542..442200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadE"
FT                   /locus_tag="SPO0426"
FT                   /product="glutamine-dependent NAD(+) synthetase"
FT                   /EC_number="6.3.5.1"
FT                   /note="identified by similarity to SP:Q03638; match to
FT                   protein family HMM PF00795; match to protein family HMM
FT                   PF02540; match to protein family HMM TIGR00552"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0426"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93744"
FT                   /db_xref="GOA:Q5LWB6"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWB6"
FT                   /protein_id="AAV93744.1"
FT                   /translation="MADRFRITLAQLNPTVGDLAGNAAKARMAWEHGREAGADLVALPE
FT                   MFVTGYNTQDLVLKPVFHDAAIAMIEALAEECADGPALAIGGPLVEEGKLYNAYLILKG
FT                   GKIVSRSLKTHLPNETVFDEVRIFDAGPLGGPYSVGNTRIGSPICEDAWHEDVAETLAE
FT                   TGAEFLLVPNGSPYYRDKYDMRINQMVARVVETGLPLIYLNMVGGQDDQVFDGGTFGLN
FT                   PGGALAFRMPVFDEAITHVDLERGSEGWQIVQGEVAPLPDAWEQDYRVMVESLRDYMRK
FT                   TGFAKVLLGLSGGVDSALVAAIATDALGPENVRCVMLPSEYTSRSSLDDAEAVAQALGV
FT                   RYDYVPISESRAAVTNTLAPLFAGTEPGLTEENIQSRLRGLLLMALSNKFGEMLLTTGN
FT                   KSEVAVGYATIYGDMAGGYNPIKDLYKTRVFETCRWRNANHRLWMMGPAGEVIRPSVID
FT                   KPPSAELREDQKDSDSLPDYPELDAILDILVDQDGSIADCVAAGFDRDVARRVEHLIYI
FT                   SEYKRYQAAPGARLTPRAFWLDRRYPIVNRWRDPS"
     MADRFRITLA QLNPTVGDLA GNAAKARMAW EHGREAGADL VALPEMFVTG YNTQDLVLKP        60
     VFHDAAIAMI EALAEECADG PALAIGGPLV EEGKLYNAYL ILKGGKIVSR SLKTHLPNET       120
     VFDEVRIFDA GPLGGPYSVG NTRIGSPICE DAWHEDVAET LAETGAEFLL VPNGSPYYRD       180
     KYDMRINQMV ARVVETGLPL IYLNMVGGQD DQVFDGGTFG LNPGGALAFR MPVFDEAITH       240
     VDLERGSEGW QIVQGEVAPL PDAWEQDYRV MVESLRDYMR KTGFAKVLLG LSGGVDSALV       300
     AAIATDALGP ENVRCVMLPS EYTSRSSLDD AEAVAQALGV RYDYVPISES RAAVTNTLAP       360
     LFAGTEPGLT EENIQSRLRG LLLMALSNKF GEMLLTTGNK SEVAVGYATI YGDMAGGYNP       420
     IKDLYKTRVF ETCRWRNANH RLWMMGPAGE VIRPSVIDKP PSAELREDQK DSDSLPDYPE       480
     LDAILDILVD QDGSIADCVA AGFDRDVARR VEHLIYISEY KRYQAAPGAR LTPRAFWLDR       540
     RYPIVNRWRD PS                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page