(data stored in ACNUC7421 zone)

EMBL: CP000031.PANB

CP000031.PANB        Location/Qualifiers
FT   CDS             104880..105719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="SPO0102"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="identified by match to protein family HMM PF02548;
FT                   match to protein family HMM TIGR00222"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93433"
FT                   /db_xref="GOA:Q5LWP5"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWP5"
FT                   /protein_id="AAV93433.1"
FT                   /translation="MSATARKTAPNAQDIRARKGGVPLVSLTAYTTPMARLMDGHCDFV
FT                   LVGDSVGMVLHGLNSTLGVTMEMMILHGQAVARGLDRAMLVIDMPFASYEEGPAQAFRN
FT                   AARLMAETGAGAVKLEGGVEMAETIRFLVKRGIPVMAHIGLTPQSINTLGGYKVQGRDD
FT                   QAQAVLADARAVADAGAFSVVLEKVPATLADRITAEVAIPTIGIGASAGCDGQILVVDD
FT                   MLGFFTAFKPKFVKRYADLGPLAEAAIAEYAAEVRARSFPAAEHVFGDQAPAKGAKA"
     MSATARKTAP NAQDIRARKG GVPLVSLTAY TTPMARLMDG HCDFVLVGDS VGMVLHGLNS        60
     TLGVTMEMMI LHGQAVARGL DRAMLVIDMP FASYEEGPAQ AFRNAARLMA ETGAGAVKLE       120
     GGVEMAETIR FLVKRGIPVM AHIGLTPQSI NTLGGYKVQG RDDQAQAVLA DARAVADAGA       180
     FSVVLEKVPA TLADRITAEV AIPTIGIGAS AGCDGQILVV DDMLGFFTAF KPKFVKRYAD       240
     LGPLAEAAIA EYAAEVRARS FPAAEHVFGD QAPAKGAKA                              279
//

If you have problems or comments...

PBIL Back to PBIL home page