(data stored in ACNUC7421 zone)

EMBL: CP000031.PANC

CP000031.PANC        Location/Qualifiers
FT   CDS             105716..106573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="SPO0103"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="identified by similarity to SP:P31663; match to
FT                   protein family HMM PF02569; match to protein family HMM
FT                   TIGR00018; match to protein family HMM TIGR00125"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93434"
FT                   /db_xref="GOA:Q5LWR2"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWR2"
FT                   /protein_id="AAV93434.1"
FT                   /translation="MSAPILRKLADLRAATAGWKRAGESIGVVPTMGALHDGHLSLVAA
FT                   AKAGCDRVVVTIFVNPKQFNNPEDLAKYPRTELADASKLAPYGVDAIYVPDPDQIYPEG
FT                   FATTVSVSGLTDVMEGACRPGHFDGVATVVAKLFLQTGADQAYFGEKDYQQMMLVTRMA
FT                   QDLDIPITVVGCPTVREASGLAMSSRNMRLSAEGLERAGRLHPVMRQVAERLAAGASFG
FT                   DLAPGAREALGAAGFVDIEYFDLRAADSLRALDRPTEPARLLVAAWLDGVRLIDNIAVS
FT                   QLND"
     MSAPILRKLA DLRAATAGWK RAGESIGVVP TMGALHDGHL SLVAAAKAGC DRVVVTIFVN        60
     PKQFNNPEDL AKYPRTELAD ASKLAPYGVD AIYVPDPDQI YPEGFATTVS VSGLTDVMEG       120
     ACRPGHFDGV ATVVAKLFLQ TGADQAYFGE KDYQQMMLVT RMAQDLDIPI TVVGCPTVRE       180
     ASGLAMSSRN MRLSAEGLER AGRLHPVMRQ VAERLAAGAS FGDLAPGARE ALGAAGFVDI       240
     EYFDLRAADS LRALDRPTEP ARLLVAAWLD GVRLIDNIAV SQLND                       285
//

If you have problems or comments...

PBIL Back to PBIL home page