(data stored in ACNUC7421 zone)

EMBL: CP000031.PE101

CP000031.PE101       Location/Qualifiers
FT   CDS             complement(103222..104709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0101"
FT                   /product="peptide/opine/nickel uptake family ABC
FT                   transporter, periplasmic substrate-binding protein"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0101"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93432"
FT                   /db_xref="GOA:Q5LWP6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWP6"
FT                   /protein_id="AAV93432.1"
FT                   /translation="MKRFVKQGVVSGLALSAALFAGAAWAKDDITIAMQLEPPHLDPTS
FT                   AAAQAIDSVVYVNIFEGLTRFMGDGSIVPALAESWEISGDGTVYTFRLHAGVTFHDGSA
FT                   MDAEDVKFSLDRARAEDSANAQKALFAGIDSVDVVDPLTVKVTLKEPNGNFLFNMAWGD
FT                   AVIVAPESIENIKTAPVGTGPYTLGEWVQGDKIVLNRNTGYWGDQPALAQATFKFISDP
FT                   TAAFAAMMAEDVDVFTGFPAPENLPQFEADPRFQVLVGSTEGETILSTNNKQAPFDNVK
FT                   VRQAMAHAIDRQAIIDGAMFGYGTPIGTHFAPHNPAYVDLTGTSAHDPDKAKALLAEAG
FT                   LPNGFETTLHLPPPSYARRGGEIIAAQLAEVGIKAEIINVEWAQWLETVFKGKDFGLTI
FT                   VSHTEPMDIGIYARPEYYFQYDNATFQELMGTLNSTTDPDKRTELMQQAQRIISEDYVN
FT                   GYLFQLAALSVAKAGVQGLWVNAPTAANDLSAISWSE"
     MKRFVKQGVV SGLALSAALF AGAAWAKDDI TIAMQLEPPH LDPTSAAAQA IDSVVYVNIF        60
     EGLTRFMGDG SIVPALAESW EISGDGTVYT FRLHAGVTFH DGSAMDAEDV KFSLDRARAE       120
     DSANAQKALF AGIDSVDVVD PLTVKVTLKE PNGNFLFNMA WGDAVIVAPE SIENIKTAPV       180
     GTGPYTLGEW VQGDKIVLNR NTGYWGDQPA LAQATFKFIS DPTAAFAAMM AEDVDVFTGF       240
     PAPENLPQFE ADPRFQVLVG STEGETILST NNKQAPFDNV KVRQAMAHAI DRQAIIDGAM       300
     FGYGTPIGTH FAPHNPAYVD LTGTSAHDPD KAKALLAEAG LPNGFETTLH LPPPSYARRG       360
     GEIIAAQLAE VGIKAEIINV EWAQWLETVF KGKDFGLTIV SHTEPMDIGI YARPEYYFQY       420
     DNATFQELMG TLNSTTDPDK RTELMQQAQR IISEDYVNGY LFQLAALSVA KAGVQGLWVN       480
     APTAANDLSA ISWSE                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page