(data stored in ACNUC9435 zone)

EMBL: CP000031.PE112

CP000031.PE112       Location/Qualifiers
FT   CDS             118243..120084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0112"
FT                   /product="poly(3-hydroxyalkanoate) polymerase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF07167"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93442"
FT                   /db_xref="GOA:Q5LWS0"
FT                   /db_xref="InterPro:IPR010941"
FT                   /db_xref="InterPro:IPR022211"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWS0"
FT                   /protein_id="AAV93442.1"
FT                   /translation="MGQARLKAVNTPRELGAKTGSGGKPLTPPISLDSPKQKTGSKPYP
FT                   DTGLPEFLDRALKARMARVTKGLSPAALAGAYLDWIVHLATSPGKQIELSENAYRKWLR
FT                   LSRHAATCSVNSNDTAPCIEPLPQDRRFRSDAWQKWPYNLIYQSFLLNQQWWYNATTGV
FT                   RGVTRQHENVMEFATRQILDMFSPSNYLLTNPEVQERTLKEGGLNLLRGFQNWLDDLDR
FT                   LQSGKPPAGAKAFRPGQEVAVTPGKVVYRNHLIELIQYTPTTDTVRPEPILIVPAWIMK
FT                   YYILDLSPENSMVKFLVDQGYTVFMISWRNPSAEDRDLGLDDYRKMGVVDAIGAVQGIV
FT                   PDQKIHGVGYCLGGTLLSISAATMGRDGGDPFASLSYLASQIDFTEPGELQLFINESQL
FT                   TFLEDMMWDHGYLDTTQMSGAFQMIGSADLVWSRSLHSYLMGDEPAMFDLLAWNADGTR
FT                   MPYRMHSEYLRSLYLNNELTEGAFVVEGRPISVTDIRVPVFSVGTVKDHVAPWPSVYKM
FT                   HLYLDTDLTFVLTSGGHNAGIVSEPGHRNRSYQIATARHGDRYVDPETWAAQTPKKDGS
FT                   WWLEWMSWLGERSGKPVPPPAMGNALTDAPGTYVHQK"
     MGQARLKAVN TPRELGAKTG SGGKPLTPPI SLDSPKQKTG SKPYPDTGLP EFLDRALKAR        60
     MARVTKGLSP AALAGAYLDW IVHLATSPGK QIELSENAYR KWLRLSRHAA TCSVNSNDTA       120
     PCIEPLPQDR RFRSDAWQKW PYNLIYQSFL LNQQWWYNAT TGVRGVTRQH ENVMEFATRQ       180
     ILDMFSPSNY LLTNPEVQER TLKEGGLNLL RGFQNWLDDL DRLQSGKPPA GAKAFRPGQE       240
     VAVTPGKVVY RNHLIELIQY TPTTDTVRPE PILIVPAWIM KYYILDLSPE NSMVKFLVDQ       300
     GYTVFMISWR NPSAEDRDLG LDDYRKMGVV DAIGAVQGIV PDQKIHGVGY CLGGTLLSIS       360
     AATMGRDGGD PFASLSYLAS QIDFTEPGEL QLFINESQLT FLEDMMWDHG YLDTTQMSGA       420
     FQMIGSADLV WSRSLHSYLM GDEPAMFDLL AWNADGTRMP YRMHSEYLRS LYLNNELTEG       480
     AFVVEGRPIS VTDIRVPVFS VGTVKDHVAP WPSVYKMHLY LDTDLTFVLT SGGHNAGIVS       540
     EPGHRNRSYQ IATARHGDRY VDPETWAAQT PKKDGSWWLE WMSWLGERSG KPVPPPAMGN       600
     ALTDAPGTYV HQK                                                          613
//

If you have problems or comments...

PBIL Back to PBIL home page