(data stored in ACNUC9435 zone)

EMBL: CP000031.PE115

CP000031.PE115       Location/Qualifiers
FT   CDS             121130..122524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0115"
FT                   /product="maoC family protein/phosphate acetyl/butaryl
FT                   transferase"
FT                   /note="identified by match to protein family HMM PF01515;
FT                   match to protein family HMM PF01575"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93445"
FT                   /db_xref="GOA:Q5LWR7"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWR7"
FT                   /protein_id="AAV93445.1"
FT                   /translation="MQYIENKTFDEIRIGDSAELTRKLKADDIELFAVMSGDVNPAHVD
FT                   EEYARSDMFHEVVAHGMWGGALISAVLGTELPGPGTIYLNQNLSFRRPVGLGDTVTVRV
FT                   TVASKDAGTKRLKLDCLCVNQDGETVIKGQAEVIAPSEKVRRPRVVLPDVHLHERGARY
FT                   RDLIAATHAMAPVRTAIVHPCDALSLTGALEAASQGLIVPILVAPRVKLEAVAEEAGLV
FT                   LDGVEIVDVPHSHAAAERAVALVRCGKAEALMKGKLHTDELMDPVVDRDTGLRSERRMS
FT                   HIFALDVPHYPKPLFVTDAAINIFPDLDTKRDIVQNAIDLAQALGIDRPKVAILSAVET
FT                   VYPKIPSTIEAAALCKMWDRGQITGGVLDGPLAFDNAVSKSAAKAKGIVSEVAGDADIL
FT                   VVPDLEAGNMIAKQLIHLAGAEAAGIVLGARVPIILTSRADGVMSRLASSAMAQLYIHH
FT                   AKKVVS"
     MQYIENKTFD EIRIGDSAEL TRKLKADDIE LFAVMSGDVN PAHVDEEYAR SDMFHEVVAH        60
     GMWGGALISA VLGTELPGPG TIYLNQNLSF RRPVGLGDTV TVRVTVASKD AGTKRLKLDC       120
     LCVNQDGETV IKGQAEVIAP SEKVRRPRVV LPDVHLHERG ARYRDLIAAT HAMAPVRTAI       180
     VHPCDALSLT GALEAASQGL IVPILVAPRV KLEAVAEEAG LVLDGVEIVD VPHSHAAAER       240
     AVALVRCGKA EALMKGKLHT DELMDPVVDR DTGLRSERRM SHIFALDVPH YPKPLFVTDA       300
     AINIFPDLDT KRDIVQNAID LAQALGIDRP KVAILSAVET VYPKIPSTIE AAALCKMWDR       360
     GQITGGVLDG PLAFDNAVSK SAAKAKGIVS EVAGDADILV VPDLEAGNMI AKQLIHLAGA       420
     EAAGIVLGAR VPIILTSRAD GVMSRLASSA MAQLYIHHAK KVVS                        464
//

If you have problems or comments...

PBIL Back to PBIL home page