(data stored in ACNUC7421 zone)

EMBL: CP000031.PE120

CP000031.PE120       Location/Qualifiers
FT   CDS             complement(130161..130448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0122"
FT                   /product="YGGT family protein"
FT                   /note="identified by match to protein family HMM PF02325"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0122"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93450"
FT                   /db_xref="GOA:Q5LWS8"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWS8"
FT                   /protein_id="AAV93450.1"
FT                   /translation="MQSLFQILMLILDVIWFFILAHVIMSWLINFQVLNMRQQLVAQIW
FT                   YGLNRVLEPIYGPIRRILPPMGGLDLTPLVVLLAIMALRIVLINNAALFY"
     MQSLFQILML ILDVIWFFIL AHVIMSWLIN FQVLNMRQQL VAQIWYGLNR VLEPIYGPIR        60
     RILPPMGGLD LTPLVVLLAI MALRIVLINN AALFY                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page