(data stored in ACNUC7421 zone)

EMBL: CP000031.PE121

CP000031.PE121       Location/Qualifiers
FT   CDS             130602..131966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0123"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0123"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93451"
FT                   /db_xref="GOA:Q5LWS7"
FT                   /db_xref="InterPro:IPR024671"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWS7"
FT                   /protein_id="AAV93451.1"
FT                   /translation="MADISARKRIWGWYFFDWASQPYHTLLVTFVFSPFFAAVAADYFL
FT                   GQGMADEAAKAQAQVVWSQCLTITGLIIGFGAPFLGAMADISGRRMTWITLFCGMYVVG
FT                   AWGLWYMDPTGGNLWWMMASFGIGFIGAEYALIFINAQLPSLGTKEEVGQISGSGFAFG
FT                   YLGGVVALFIMLLLFVEQGNGKTLVGLDPVLGLDPDTREGTRAVGPFTALWFVIFMIPY
FT                   FLWVREPAGSGRRGSFAEAVAMVVQSVKNLRHRGSLASYLASSMFYRDALNGLYGFGGV
FT                   YARLVLGWEITMIGVFGIIAAISAAAFSWLGGLADRRVGPKPVIVGSILVLILVCATIV
FT                   GMDRTQIFGIPLAEGSGLPDFVFFFCGVLIGGFGGIVQAASRSLMVRHTDPEMPTESFG
FT                   LYGLSGRATAFLAPALIGAATAATGSARLGVSPVVGLFILGLILLIWVKPQGDQK"
     MADISARKRI WGWYFFDWAS QPYHTLLVTF VFSPFFAAVA ADYFLGQGMA DEAAKAQAQV        60
     VWSQCLTITG LIIGFGAPFL GAMADISGRR MTWITLFCGM YVVGAWGLWY MDPTGGNLWW       120
     MMASFGIGFI GAEYALIFIN AQLPSLGTKE EVGQISGSGF AFGYLGGVVA LFIMLLLFVE       180
     QGNGKTLVGL DPVLGLDPDT REGTRAVGPF TALWFVIFMI PYFLWVREPA GSGRRGSFAE       240
     AVAMVVQSVK NLRHRGSLAS YLASSMFYRD ALNGLYGFGG VYARLVLGWE ITMIGVFGII       300
     AAISAAAFSW LGGLADRRVG PKPVIVGSIL VLILVCATIV GMDRTQIFGI PLAEGSGLPD       360
     FVFFFCGVLI GGFGGIVQAA SRSLMVRHTD PEMPTESFGL YGLSGRATAF LAPALIGAAT       420
     AATGSARLGV SPVVGLFILG LILLIWVKPQ GDQK                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page