(data stored in ACNUC9435 zone)

EMBL: CP000031.PE124

CP000031.PE124       Location/Qualifiers
FT   CDS             133714..134445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0126"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF02592;
FT                   match to protein family HMM TIGR00697"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0126"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93454"
FT                   /db_xref="GOA:Q5LWS4"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWS4"
FT                   /protein_id="AAV93454.1"
FT                   /translation="MLRAKRPACPRSRRTKSPHPCQNGPRNMTRAFLPGILAMAAIVVA
FT                   SNILVQFLILDGLLTWGAFTYPLAFLVTDVMNRVYGAEAARRVVFAGFVTGVICSLIGS
FT                   QIVLQGDGYTYAAVPLRIAVASGSAFLIAQLTDVAVFNRFRGGRWWRAPLVSTLIGSAL
FT                   DTALFFTIAFSASITLFGPDADTAVNWAWEAVPFMNKGAPMPLWVTLAFADWLVKLSLA
FT                   LIALVPFRVIVQRLAPARATA"
     MLRAKRPACP RSRRTKSPHP CQNGPRNMTR AFLPGILAMA AIVVASNILV QFLILDGLLT        60
     WGAFTYPLAF LVTDVMNRVY GAEAARRVVF AGFVTGVICS LIGSQIVLQG DGYTYAAVPL       120
     RIAVASGSAF LIAQLTDVAV FNRFRGGRWW RAPLVSTLIG SALDTALFFT IAFSASITLF       180
     GPDADTAVNW AWEAVPFMNK GAPMPLWVTL AFADWLVKLS LALIALVPFR VIVQRLAPAR       240
     ATA                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page