(data stored in ACNUC7421 zone)

EMBL: CP000031.PE125

CP000031.PE125       Location/Qualifiers
FT   CDS             134704..135123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0127"
FT                   /product="peptidyl-tRNA hydrolase domain protein"
FT                   /note="identified by similarity to GB:AAM35138.1; match to
FT                   protein family HMM PF00472"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93455"
FT                   /db_xref="GOA:Q5LWS3"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWS3"
FT                   /protein_id="AAV93455.1"
FT                   /translation="MLYVTDDIAIQDWELSESFMRASGPGGQNVNKVSSAVELRFEAAR
FT                   SPSLPAPVKARLKRLAGRRWTGEGAIVLQCDETRSQARNREIVRARLVELIARALVAPK
FT                   RRIATKPTRGSVRRRLDSKKARGEVKALRGKIGDE"
     MLYVTDDIAI QDWELSESFM RASGPGGQNV NKVSSAVELR FEAARSPSLP APVKARLKRL        60
     AGRRWTGEGA IVLQCDETRS QARNREIVRA RLVELIARAL VAPKRRIATK PTRGSVRRRL       120
     DSKKARGEVK ALRGKIGDE                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page