(data stored in ACNUC7421 zone)

EMBL: CP000031.PE127

CP000031.PE127       Location/Qualifiers
FT   CDS             135951..136958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0129"
FT                   /product="peptidase, T4 family"
FT                   /note="identified by match to protein family HMM PF03576"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0129"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93457"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWS1"
FT                   /protein_id="AAV93457.1"
FT                   /translation="MVPGPRNLITDVPGLLVGNAQDDALKSGATVLSAEAPFMASVHVM
FT                   GGAPGTRETDLLAPDKSVARIDALVLSGGSAYGLDACSGVSDALRAAGRGYRIADAVIP
FT                   IVPGAIIFDLLNGGDKDWADNPYRALGRAAFDAAGRDFALGTTGAGTGALTAMLKGGLG
FT                   SASLVLPDGTTVGALVAANPMGSVTTPGDRHFWAAPFEIDGEFGGLGPDPSGGLGRQLE
FT                   SRKIRMMSAQAQDRANTTIAIVATDADLTKAQCQRMAVAAHDGIARATVPAHSPGDGDL
FT                   VFSVSTGARPMAAPERDLTLLGHAAALCLARAIARAIYLARPAPGDLLPCWHQA"
     MVPGPRNLIT DVPGLLVGNA QDDALKSGAT VLSAEAPFMA SVHVMGGAPG TRETDLLAPD        60
     KSVARIDALV LSGGSAYGLD ACSGVSDALR AAGRGYRIAD AVIPIVPGAI IFDLLNGGDK       120
     DWADNPYRAL GRAAFDAAGR DFALGTTGAG TGALTAMLKG GLGSASLVLP DGTTVGALVA       180
     ANPMGSVTTP GDRHFWAAPF EIDGEFGGLG PDPSGGLGRQ LESRKIRMMS AQAQDRANTT       240
     IAIVATDADL TKAQCQRMAV AAHDGIARAT VPAHSPGDGD LVFSVSTGAR PMAAPERDLT       300
     LLGHAAALCL ARAIARAIYL ARPAPGDLLP CWHQA                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page