(data stored in ACNUC7421 zone)

EMBL: CP000031.PE128

CP000031.PE128       Location/Qualifiers
FT   CDS             137081..137494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0130"
FT                   /product="cytochrome c family protein"
FT                   /note="identified by match to protein family HMM PF00034"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93458"
FT                   /db_xref="GOA:Q5LWT7"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWT7"
FT                   /protein_id="AAV93458.1"
FT                   /translation="MNRFVAAAFACVLAVPALAEGDAAKGEKGFNKCKSCHMIESPAGE
FT                   TIVKGGKTGPNLYGVVGRAAGTYEGYKYGDSLVAAGEKGLVWDEESFVAFTQDPKSFLN
FT                   TYLGETAAKSKMTFKLKSGGEDVFAYLQSVAAE"
     MNRFVAAAFA CVLAVPALAE GDAAKGEKGF NKCKSCHMIE SPAGETIVKG GKTGPNLYGV        60
     VGRAAGTYEG YKYGDSLVAA GEKGLVWDEE SFVAFTQDPK SFLNTYLGET AAKSKMTFKL       120
     KSGGEDVFAY LQSVAAE                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page