(data stored in ACNUC7421 zone)

EMBL: CP000031.PE129

CP000031.PE129       Location/Qualifiers
FT   CDS             137668..138210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SPO0131"
FT                   /product="isopentyl-diphosphate delta-isomerase"
FT                   /EC_number="5.3.3.2"
FT                   /note="identified by similarity to SP:P26173; match to
FT                   protein family HMM PF00293; match to protein family HMM
FT                   TIGR02150"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93459"
FT                   /db_xref="GOA:Q5LWT6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR011876"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWT6"
FT                   /protein_id="AAV93459.1"
FT                   /translation="MGILIPAWVDDRLVPVDKLEAHEKGLKHKAVSVFAVRDMDILIQR
FT                   RALGKYHTPGLWANTCCTHPDWDESASTCAVRRLREELGITGLYPEYRHRLEYHADVGN
FT                   GMVENEVVDVFLAHVRGPLQVVPNPDEVMEIRWIGYHDLLAEVQRYPERFTPWLKIYLH
FT                   HHADTIFGPDLIISAKA"
     MGILIPAWVD DRLVPVDKLE AHEKGLKHKA VSVFAVRDMD ILIQRRALGK YHTPGLWANT        60
     CCTHPDWDES ASTCAVRRLR EELGITGLYP EYRHRLEYHA DVGNGMVENE VVDVFLAHVR       120
     GPLQVVPNPD EVMEIRWIGY HDLLAEVQRY PERFTPWLKI YLHHHADTIF GPDLIISAKA       180
//

If you have problems or comments...

PBIL Back to PBIL home page